14-3-3 protein eta

Details

Name
14-3-3 protein eta
Synonyms
  • Protein AS1
  • YWHA1
Gene Name
YWHAH
Organism
Humans
Amino acid sequence
>lcl|BSEQ0049795|14-3-3 protein eta
MGDREQLLQRARLAEQAERYDDMASAMKAVTELNEPLSNEDRNLLSVAYKNVVGARRSSW
RVISSIEQKTMADGNEKKLEKVKAYREKIEKELETVCNDVLSLLDKFLIKNCNDFQYESK
VFYLKMKGDYYRYLAEVASGEKKNSVVEASEAAYKEAFEISKEQMQPTHPIRLGLALNFS
VFYYEIQNAPEQACLLAKQAFDDAIAELDTLNEDSYKDSTLIMQLLRDNLTLWTSDQQDE
EAGEGN
Number of residues
246
Molecular Weight
28218.445
Theoretical pI
Not Available
GO Classification
Functions
actin binding / enzyme binding / glucocorticoid receptor binding / insulin-like growth factor receptor binding / ion channel binding / protein domain specific binding / protein heterodimerization activity / sodium channel regulator activity
Processes
glucocorticoid catabolic process / glucocorticoid receptor signaling pathway / intracellular protein transport / membrane depolarization during action potential / membrane organization / negative regulation of dendrite morphogenesis / positive regulation of protein insertion into mitochondrial membrane involved in apoptotic signaling pathway / positive regulation of transcription, DNA-templated / regulation of neuron differentiation / regulation of sodium ion transmembrane transporter activity / regulation of sodium ion transport / regulation of synaptic plasticity / substantia nigra development
Components
cytoplasm / cytoplasmic vesicle membrane / cytosol / extracellular exosome / intercalated disc / mitochondrion / plasma membrane
General Function
Adapter protein implicated in the regulation of a large spectrum of both general and specialized signaling pathways. Binds to a large number of partners, usually by recognition of a phosphoserine or phosphothreonine motif. Binding generally results in the modulation of the activity of the binding partner. Negatively regulates the kinase activity of PDPK1.
Specific Function
Actin binding
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0049796|14-3-3 protein eta (YWHAH)
ATGGGGGACCGGGAGCAGCTGCTGCAGCGGGCGCGGCTGGCCGAGCAGGCGGAGCGCTAC
GACGACATGGCCTCCGCTATGAAGGCGGTGACAGAGCTGAATGAACCTCTCTCCAATGAA
GATCGAAATCTCCTCTCTGTGGCCTACAAGAATGTGGTTGGTGCCAGGCGATCTTCCTGG
AGGGTCATTAGCAGCATTGAGCAGAAAACCATGGCTGATGGAAACGAAAAGAAATTGGAG
AAAGTTAAAGCTTACCGGGAGAAGATTGAGAAGGAGCTGGAGACAGTTTGCAATGATGTC
CTGTCTCTGCTTGACAAGTTCCTGATCAAGAACTGCAATGATTTCCAGTATGAGAGCAAG
GTGTTTTACCTGAAAATGAAGGGTGATTACTACCGCTACTTAGCAGAGGTCGCTTCTGGG
GAGAAGAAAAACAGTGTGGTCGAAGCTTCTGAAGCTGCCTACAAGGAAGCCTTTGAAATC
AGCAAAGAGCAGATGCAACCCACGCATCCCATCCGGCTGGGCCTGGCCCTCAACTTCTCC
GTGTTCTACTATGAGATCCAGAATGCACCTGAGCAAGCCTGCCTCTTAGCCAAACAAGCC
TTCGATGATGCCATAGCTGAGCTGGACACACTAAACGAGGATTCCTATAAGGACTCCACG
CTGATCATGCAGTTGCTGCGAGACAACCTCACCCTCTGGACGAGCGACCAGCAGGATGAA
GAAGCAGGAGAAGGCAACTGA
Chromosome Location
22
Locus
22q12.3
External Identifiers
ResourceLink
UniProtKB IDQ04917
UniProtKB Entry Name1433F_HUMAN
HGNC IDHGNC:12853
General References
  1. Swanson KD, Dhar MS, Joshi JG: The human and bovine 14-3-3 eta protein mRNAs are highly conserved in both their translated and untranslated regions. Biochim Biophys Acta. 1993 Oct 19;1216(1):145-8. [Article]
  2. Ichimura-Ohshima Y, Morii K, Ichimura T, Araki K, Takahashi Y, Isobe T, Minoshima S, Fukuyama R, Shimizu N, Kuwano R: cDNA cloning and chromosome assignment of the gene for human brain 14-3-3 protein eta chain. J Neurosci Res. 1992 Apr;31(4):600-5. [Article]
  3. Muratake T, Hayashi S, Ichimura Y, Morii K, Kuwano R, Ichikawa T, Kumanishi T, Isobe T, Watanabe M, Kondo H, et al.: The effect on methamphetamine on the mRNA level for 14.3.3 eta chain in the human cultured cells. Mol Neurobiol. 1995 Aug-Dec;11(1-3):223-30. [Article]
  4. Muratake T, Hayashi S, Ichikawa T, Kumanishi T, Ichimura Y, Kuwano R, Isobe T, Wang Y, Minoshima S, Shimizu N, Takahashi Y: Structural organization and chromosomal assignment of the human 14-3-3 eta chain gene (YWHAH). Genomics. 1996 Aug 15;36(1):63-9. [Article]
  5. Collins JE, Wright CL, Edwards CA, Davis MP, Grinham JA, Cole CG, Goward ME, Aguado B, Mallya M, Mokrab Y, Huckle EJ, Beare DM, Dunham I: A genome annotation-driven approach to cloning the human ORFeome. Genome Biol. 2004;5(10):R84. Epub 2004 Sep 30. [Article]
  6. Dunham I, Shimizu N, Roe BA, Chissoe S, Hunt AR, Collins JE, Bruskiewich R, Beare DM, Clamp M, Smink LJ, Ainscough R, Almeida JP, Babbage A, Bagguley C, Bailey J, Barlow K, Bates KN, Beasley O, Bird CP, Blakey S, Bridgeman AM, Buck D, Burgess J, Burrill WD, O'Brien KP, et al.: The DNA sequence of human chromosome 22. Nature. 1999 Dec 2;402(6761):489-95. [Article]
  7. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
  8. Leffers H, Madsen P, Rasmussen HH, Honore B, Andersen AH, Walbum E, Vandekerckhove J, Celis JE: Molecular cloning and expression of the transformation sensitive epithelial marker stratifin. A member of a protein family that has been involved in the protein kinase C signalling pathway. J Mol Biol. 1993 Jun 20;231(4):982-98. [Article]
  9. Gevaert K, Goethals M, Martens L, Van Damme J, Staes A, Thomas GR, Vandekerckhove J: Exploring proteomes and analyzing protein processing by mass spectrometric identification of sorted N-terminal peptides. Nat Biotechnol. 2003 May;21(5):566-9. Epub 2003 Mar 31. [Article]
  10. Greninger AL, Knudsen GM, Betegon M, Burlingame AL, DeRisi JL: ACBD3 interaction with TBC1 domain 22 protein is differentially affected by enteroviral and kobuviral 3A protein binding. MBio. 2013 Apr 9;4(2):e00098-13. doi: 10.1128/mBio.00098-13. [Article]
  11. Zilliacus J, Holter E, Wakui H, Tazawa H, Treuter E, Gustafsson JA: Regulation of glucocorticoid receptor activity by 14--3-3-dependent intracellular relocalization of the corepressor RIP140. Mol Endocrinol. 2001 Apr;15(4):501-11. [Article]
  12. Sato S, Fujita N, Tsuruo T: Regulation of kinase activity of 3-phosphoinositide-dependent protein kinase-1 by binding to 14-3-3. J Biol Chem. 2002 Oct 18;277(42):39360-7. Epub 2002 Aug 12. [Article]
  13. Fujita N, Sato S, Tsuruo T: Phosphorylation of p27Kip1 at threonine 198 by p90 ribosomal protein S6 kinases promotes its binding to 14-3-3 and cytoplasmic localization. J Biol Chem. 2003 Dec 5;278(49):49254-60. Epub 2003 Sep 22. [Article]
  14. Yoshida K, Yamaguchi T, Natsume T, Kufe D, Miki Y: JNK phosphorylation of 14-3-3 proteins regulates nuclear targeting of c-Abl in the apoptotic response to DNA damage. Nat Cell Biol. 2005 Mar;7(3):278-85. [Article]
  15. Brummer T, Larance M, Herrera Abreu MT, Lyons RJ, Timpson P, Emmerich CH, Fleuren ED, Lehrbach GM, Schramek D, Guilhaus M, James DE, Daly RJ: Phosphorylation-dependent binding of 14-3-3 terminates signalling by the Gab2 docking protein. EMBO J. 2008 Sep 3;27(17):2305-16. [Article]
  16. Kajiwara Y, Buxbaum JD, Grice DE: SLITRK1 binds 14-3-3 and regulates neurite outgrowth in a phosphorylation-dependent manner. Biol Psychiatry. 2009 Nov 15;66(10):918-25. doi: 10.1016/j.biopsych.2009.05.033. Epub 2009 Jul 29. [Article]
  17. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [Article]
  18. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [Article]
  19. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [Article]
  20. Yuasa K, Ota R, Matsuda S, Isshiki K, Inoue M, Tsuji A: Suppression of death-associated protein kinase 2 by interaction with 14-3-3 proteins. Biochem Biophys Res Commun. 2015 Aug 14;464(1):70-5. doi: 10.1016/j.bbrc.2015.05.105. Epub 2015 Jun 3. [Article]
  21. Vaca Jacome AS, Rabilloud T, Schaeffer-Reiss C, Rompais M, Ayoub D, Lane L, Bairoch A, Van Dorsselaer A, Carapito C: N-terminome analysis of the human mitochondrial proteome. Proteomics. 2015 Jul;15(14):2519-24. doi: 10.1002/pmic.201400617. Epub 2015 Jun 8. [Article]
  22. Yang X, Lee WH, Sobott F, Papagrigoriou E, Robinson CV, Grossmann JG, Sundstrom M, Doyle DA, Elkins JM: Structural basis for protein-protein interactions in the 14-3-3 protein family. Proc Natl Acad Sci U S A. 2006 Nov 14;103(46):17237-42. Epub 2006 Nov 3. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB12695Phenethyl IsothiocyanateinvestigationalunknownDetails