Prolow-density lipoprotein receptor-related protein 1

Details

Name
Prolow-density lipoprotein receptor-related protein 1
Synonyms
  • A2MR
  • Alpha-2-macroglobulin receptor
  • APOER
  • Apolipoprotein E receptor
  • APR
  • LRP-1
Gene Name
LRP1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0037158|Prolow-density lipoprotein receptor-related protein 1
MLTPPLLLLLPLLSALVAAAIDAPKTCSPKQFACRDQITCISKGWRCDGERDCPDGSDEA
PEICPQSKAQRCQPNEHNCLGTELCVPMSRLCNGVQDCMDGSDEGPHCRELQGNCSRLGC
QHHCVPTLDGPTCYCNSSFQLQADGKTCKDFDECSVYGTCSQLCTNTDGSFICGCVEGYL
LQPDNRSCKAKNEPVDRPPVLLIANSQNILATYLSGAQVSTITPTSTRQTTAMDFSYANE
TVCWVHVGDSAAQTQLKCARMPGLKGFVDEHTINISLSLHHVEQMAIDWLTGNFYFVDDI
DDRIFVCNRNGDTCVTLLDLELYNPKGIALDPAMGKVFFTDYGQIPKVERCDMDGQNRTK
LVDSKIVFPHGITLDLVSRLVYWADAYLDYIEVVDYEGKGRQTIIQGILIEHLYGLTVFE
NYLYATNSDNANAQQKTSVIRVNRFNSTEYQVVTRVDKGGALHIYHQRRQPRVRSHACEN
DQYGKPGGCSDICLLANSHKARTCRCRSGFSLGSDGKSCKKPEHELFLVYGKGRPGIIRG
MDMGAKVPDEHMIPIENLMNPRALDFHAETGFIYFADTTSYLIGRQKIDGTERETILKDG
IHNVEGVAVDWMGDNLYWTDDGPKKTISVARLEKAAQTRKTLIEGKMTHPRAIVVDPLNG
WMYWTDWEEDPKDSRRGRLERAWMDGSHRDIFVTSKTVLWPNGLSLDIPAGRLYWVDAFY
DRIETILLNGTDRKIVYEGPELNHAFGLCHHGNYLFWTEYRSGSVYRLERGVGGAPPTVT
LLRSERPPIFEIRMYDAQQQQVGTNKCRVNNGGCSSLCLATPGSRQCACAEDQVLDADGV
TCLANPSYVPPPQCQPGEFACANSRCIQERWKCDGDNDCLDNSDEAPALCHQHTCPSDRF
KCENNRCIPNRWLCDGDNDCGNSEDESNATCSARTCPPNQFSCASGRCIPISWTCDLDDD
CGDRSDESASCAYPTCFPLTQFTCNNGRCININWRCDNDNDCGDNSDEAGCSHSCSSTQF
KCNSGRCIPEHWTCDGDNDCGDYSDETHANCTNQATRPPGGCHTDEFQCRLDGLCIPLRW
RCDGDTDCMDSSDEKSCEGVTHVCDPSVKFGCKDSARCISKAWVCDGDNDCEDNSDEENC
ESLACRPPSHPCANNTSVCLPPDKLCDGNDDCGDGSDEGELCDQCSLNNGGCSHNCSVAP
GEGIVCSCPLGMELGPDNHTCQIQSYCAKHLKCSQKCDQNKFSVKCSCYEGWVLEPDGES
CRSLDPFKPFIIFSNRHEIRRIDLHKGDYSVLVPGLRNTIALDFHLSQSALYWTDVVEDK
IYRGKLLDNGALTSFEVVIQYGLATPEGLAVDWIAGNIYWVESNLDQIEVAKLDGTLRTT
LLAGDIEHPRAIALDPRDGILFWTDWDASLPRIEAASMSGAGRRTVHRETGSGGWPNGLT
VDYLEKRILWIDARSDAIYSARYDGSGHMEVLRGHEFLSHPFAVTLYGGEVYWTDWRTNT
LAKANKWTGHNVTVVQRTNTQPFDLQVYHPSRQPMAPNPCEANGGQGPCSHLCLINYNRT
VSCACPHLMKLHKDNTTCYEFKKFLLYARQMEIRGVDLDAPYYNYIISFTVPDIDNVTVL
DYDAREQRVYWSDVRTQAIKRAFINGTGVETVVSADLPNAHGLAVDWVSRNLFWTSYDTN
KKQINVARLDGSFKNAVVQGLEQPHGLVVHPLRGKLYWTDGDNISMANMDGSNRTLLFSG
QKGPVGLAIDFPESKLYWISSGNHTINRCNLDGSGLEVIDAMRSQLGKATALAIMGDKLW
WADQVSEKMGTCSKADGSGSVVLRNSTTLVMHMKVYDESIQLDHKGTNPCSVNNGDCSQL
CLPTSETTRSCMCTAGYSLRSGQQACEGVGSFLLYSVHEGIRGIPLDPNDKSDALVPVSG
TSLAVGIDFHAENDTIYWVDMGLSTISRAKRDQTWREDVVTNGIGRVEGIAVDWIAGNIY
WTDQGFDVIEVARLNGSFRYVVISQGLDKPRAITVHPEKGYLFWTEWGQYPRIERSRLDG
TERVVLVNVSISWPNGISVDYQDGKLYWCDARTDKIERIDLETGENREVVLSSNNMDMFS
VSVFEDFIYWSDRTHANGSIKRGSKDNATDSVPLRTGIGVQLKDIKVFNRDRQKGTNVCA
VANGGCQQLCLYRGRGQRACACAHGMLAEDGASCREYAGYLLYSERTILKSIHLSDERNL
NAPVQPFEDPEHMKNVIALAFDYRAGTSPGTPNRIFFSDIHFGNIQQINDDGSRRITIVE
NVGSVEGLAYHRGWDTLYWTSYTTSTITRHTVDQTRPGAFERETVITMSGDDHPRAFVLD
ECQNLMFWTNWNEQHPSIMRAALSGANVLTLIEKDIRTPNGLAIDHRAEKLYFSDATLDK
IERCEYDGSHRYVILKSEPVHPFGLAVYGEHIFWTDWVRRAVQRANKHVGSNMKLLRVDI
PQQPMGIIAVANDTNSCELSPCRINNGGCQDLCLLTHQGHVNCSCRGGRILQDDLTCRAV
NSSCRAQDEFECANGECINFSLTCDGVPHCKDKSDEKPSYCNSRRCKKTFRQCSNGRCVS
NMLWCNGADDCGDGSDEIPCNKTACGVGEFRCRDGTCIGNSSRCNQFVDCEDASDEMNCS
ATDCSSYFRLGVKGVLFQPCERTSLCYAPSWVCDGANDCGDYSDERDCPGVKRPRCPLNY
FACPSGRCIPMSWTCDKEDDCEHGEDETHCNKFCSEAQFECQNHRCISKQWLCDGSDDCG
DGSDEAAHCEGKTCGPSSFSCPGTHVCVPERWLCDGDKDCADGADESIAAGCLYNSTCDD
REFMCQNRQCIPKHFVCDHDRDCADGSDESPECEYPTCGPSEFRCANGRCLSSRQWECDG
ENDCHDQSDEAPKNPHCTSQEHKCNASSQFLCSSGRCVAEALLCNGQDDCGDSSDERGCH
INECLSRKLSGCSQDCEDLKIGFKCRCRPGFRLKDDGRTCADVDECSTTFPCSQRCINTH
GSYKCLCVEGYAPRGGDPHSCKAVTDEEPFLIFANRYYLRKLNLDGSNYTLLKQGLNNAV
ALDFDYREQMIYWTDVTTQGSMIRRMHLNGSNVQVLHRTGLSNPDGLAVDWVGGNLYWCD
KGRDTIEVSKLNGAYRTVLVSSGLREPRALVVDVQNGYLYWTDWGDHSLIGRIGMDGSSR
SVIVDTKITWPNGLTLDYVTERIYWADAREDYIEFASLDGSNRHVVLSQDIPHIFALTLF
EDYVYWTDWETKSINRAHKTTGTNKTLLISTLHRPMDLHVFHALRQPDVPNHPCKVNNGG
CSNLCLLSPGGGHKCACPTNFYLGSDGRTCVSNCTASQFVCKNDKCIPFWWKCDTEDDCG
DHSDEPPDCPEFKCRPGQFQCSTGICTNPAFICDGDNDCQDNSDEANCDIHVCLPSQFKC
TNTNRCIPGIFRCNGQDNCGDGEDERDCPEVTCAPNQFQCSITKRCIPRVWVCDRDNDCV
DGSDEPANCTQMTCGVDEFRCKDSGRCIPARWKCDGEDDCGDGSDEPKEECDERTCEPYQ
FRCKNNRCVPGRWQCDYDNDCGDNSDEESCTPRPCSESEFSCANGRCIAGRWKCDGDHDC
ADGSDEKDCTPRCDMDQFQCKSGHCIPLRWRCDADADCMDGSDEEACGTGVRTCPLDEFQ
CNNTLCKPLAWKCDGEDDCGDNSDENPEECARFVCPPNRPFRCKNDRVCLWIGRQCDGTD
NCGDGTDEEDCEPPTAHTTHCKDKKEFLCRNQRCLSSSLRCNMFDDCGDGSDEEDCSIDP
KLTSCATNASICGDEARCVRTEKAAYCACRSGFHTVPGQPGCQDINECLRFGTCSQLCNN
TKGGHLCSCARNFMKTHNTCKAEGSEYQVLYIADDNEIRSLFPGHPHSAYEQAFQGDESV
RIDAMDVHVKAGRVYWTNWHTGTISYRSLPPAAPPTTSNRHRRQIDRGVTHLNISGLKMP
RGIAIDWVAGNVYWTDSGRDVIEVAQMKGENRKTLISGMIDEPHAIVVDPLRGTMYWSDW
GNHPKIETAAMDGTLRETLVQDNIQWPTGLAVDYHNERLYWADAKLSVIGSIRLNGTDPI
VAADSKRGLSHPFSIDVFEDYIYGVTYINNRVFKIHKFGHSPLVNLTGGLSHASDVVLYH
QHKQPEVTNPCDRKKCEWLCLLSPSGPVCTCPNGKRLDNGTCVPVPSPTPPPDAPRPGTC
NLQCFNGGSCFLNARRQPKCRCQPRYTGDKCELDQCWEHCRNGGTCAASPSGMPTCRCPT
GFTGPKCTQQVCAGYCANNSTCTVNQGNQPQCRCLPGFLGDRCQYRQCSGYCENFGTCQM
AADGSRQCRCTAYFEGSRCEVNKCSRCLEGACVVNKQSGDVTCNCTDGRVAPSCLTCVGH
CSNGGSCTMNSKMMPECQCPPHMTGPRCEEHVFSQQQPGHIASILIPLLLLLLLVLVAGV
VFWYKRRVQGAKGFQHQRMTNGAMNVEIGNPTYKMYEGGEPDDVGGLLDADFALDPDKPT
NFTNPVYATLYMGGHGSRHSLASTDEKRELLGRGPEDEIGDPLA
Number of residues
4544
Molecular Weight
504601.695
Theoretical pI
5.02
GO Classification
Functions
apolipoprotein binding / calcium ion binding / lipoprotein particle receptor binding / lipoprotein transporter activity / poly(A) RNA binding / protein complex binding / receptor activity
Processes
aging / aorta morphogenesis / apoptotic cell clearance / beta-amyloid clearance / cell proliferation / lipoprotein metabolic process / lipoprotein transport / negative regulation of neuron apoptotic process / negative regulation of neuron projection development / negative regulation of platelet-derived growth factor receptor-beta signaling pathway / negative regulation of smooth muscle cell migration / negative regulation of Wnt signaling pathway / phototransduction, visible light / positive regulation of cholesterol efflux / positive regulation of lipid transport / positive regulation of protein transport / protein kinase C-activating G-protein coupled receptor signaling pathway / receptor-mediated endocytosis / regulation of actin cytoskeleton organization / regulation of cholesterol transport / regulation of phospholipase A2 activity / retinoid metabolic process
Components
clathrin-coated vesicle / coated pit / cytoplasm / dendrite / endocytic vesicle membrane / endosome / focal adhesion / integral component of plasma membrane / lysosomal membrane / neuronal cell body / nucleolus / plasma membrane / receptor complex
General Function
Receptor activity
Specific Function
Endocytic receptor involved in endocytosis and in phagocytosis of apoptotic cells. Required for early embryonic development. Involved in cellular lipid homeostasis. Involved in the plasma clearance of chylomicron remnants and activated LRPAP1 (alpha 2-macroglobulin), as well as the local metabolism of complexes between plasminogen activators and their endogenous inhibitors. May modulate cellular events, such as APP metabolism, kinase-dependent intracellular signaling, neuronal calcium signaling as well as neurotransmission.Functions as a receptor for Pseudomonas aeruginosa exotoxin A.
Pfam Domain Function
Transmembrane Regions
4420-4444
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0019236|Prolow-density lipoprotein receptor-related protein 1 (LRP1)
ATGCTGACCCCGCCGTTGCTCCTGCTGCTGCCCCTGCTCTCAGCTCTGGTCGCGGCGGCT
ATCGACGCCCCTAAGACTTGCAGCCCCAAGCAGTTTGCCTGCAGAGATCAAATAACCTGT
ATCTCAAAGGGCTGGCGGTGCGACGGTGAGAGGGACTGCCCAGACGGATCTGACGAGGCC
CCTGAGATTTGTCCACAGAGTAAGGCCCAGCGATGCCAGCCAAACGAGCATAACTGCCTG
GGTACTGAGCTGTGTGTTCCCATGTCCCGCCTCTGCAATGGGGTCCAGGACTGCATGGAC
GGCTCAGATGAGGGGCCCCACTGCCGAGAGCTCCAAGGCAACTGCTCTCGCCTGGGCTGC
CAGCACCATTGTGTCCCCACACTCGATGGGCCCACCTGCTACTGCAACAGCAGCTTTCAG
CTTCAGGCAGATGGCAAGACCTGCAAAGATTTTGATGAGTGCTCAGTGTACGGCACCTGC
AGCCAGCTATGCACCAACACAGACGGCTCCTTCATATGTGGCTGTGTTGAAGGATACCTC
CTGCAGCCGGATAACCGCTCCTGCAAGGCCAAGAACGAGCCAGTAGACCGGCCCCCTGTG
CTGTTGATAGCCAACTCCCAGAACATCTTGGCCACGTACCTGAGTGGGGCCCAGGTGTCT
ACCATCACACCTACGAGCACGCGGCAGACCACAGCCATGGACTTCAGCTATGCCAACGAG
ACCGTATGCTGGGTGCATGTTGGGGACAGTGCTGCTCAGACGCAGCTCAAGTGTGCCCGC
ATGCCTGGCCTAAAGGGCTTCGTGGATGAGCACACCATCAACATCTCCCTCAGTCTGCAC
CACGTGGAACAGATGGCCATCGACTGGCTGACAGGCAACTTCTACTTTGTGGATGACATC
GATGATAGGATCTTTGTCTGCAACAGAAATGGGGACACATGTGTCACATTGCTAGACCTG
GAACTCTACAACCCCAAGGGCATTGCCCTGGACCCTGCCATGGGGAAGGTGTTTTTCACT
GACTATGGGCAGATCCCAAAGGTGGAACGCTGTGACATGGATGGGCAGAACCGCACCAAG
CTCGTCGACAGCAAGATTGTGTTTCCTCATGGCATCACGCTGGACCTGGTCAGCCGCCTT
GTCTACTGGGCAGATGCCTATCTGGACTATATTGAAGTGGTGGACTATGAGGGCAAGGGC
CGCCAGACCATCATCCAGGGCATCCTGATTGAGCACCTGTACGGCCTGACTGTGTTTGAG
AATTATCTCTATGCCACCAACTCGGACAATGCCAATGCCCAGCAGAAGACGAGTGTGATC
CGTGTGAACCGCTTTAACAGCACCGAGTACCAGGTTGTCACCCGGGTGGACAAGGGTGGT
GCCCTCCACATCTACCACCAGAGGCGTCAGCCCCGAGTGAGGAGCCATGCCTGTGAAAAC
GACCAGTATGGGAAGCCGGGTGGCTGCTCTGACATCTGCCTGCTGGCCAACAGCCACAAG
GCGCGGACCTGCCGCTGCCGTTCCGGCTTCAGCCTGGGCAGTGACGGGAAGTCATGCAAG
AAGCCGGAGCATGAGCTGTTCCTCGTGTATGGCAAGGGCCGGCCAGGCATCATCCGGGGC
ATGGATATGGGGGCCAAGGTCCCGGATGAGCACATGATCCCCATTGAAAACCTCATGAAC
CCCCGAGCCCTGGACTTCCACGCTGAGACCGGCTTCATCTACTTTGCCGACACCACCAGC
TACCTCATTGGCCGCCAGAAGATTGATGGCACTGAGCGGGAGACCATCCTGAAGGACGGC
ATCCACAATGTGGAGGGTGTGGCCGTGGACTGGATGGGAGACAATCTGTACTGGACGGAC
GATGGGCCCAAAAAGACAATCAGCGTGGCCAGGCTGGAGAAAGCTGCTCAGACCCGCAAG
ACTTTAATCGAGGGCAAAATGACACACCCCAGGGCTATTGTGGTGGATCCACTCAATGGG
TGGATGTACTGGACAGACTGGGAGGAGGACCCCAAGGACAGTCGGCGTGGGCGGCTGGAG
AGGGCGTGGATGGATGGCTCACACCGAGACATCTTTGTCACCTCCAAGACAGTGCTTTGG
CCCAATGGGCTAAGCCTGGACATCCCGGCTGGGCGCCTCTACTGGGTGGATGCCTTCTAC
GACCGCATCGAGACGATACTGCTCAATGGCACAGACCGGAAGATTGTGTATGAAGGTCCT
GAGCTGAACCACGCCTTTGGCCTGTGTCACCATGGCAACTACCTCTTCTGGACTGAGTAT
CGGAGTGGCAGTGTCTACCGCTTGGAACGGGGTGTAGGAGGCGCACCCCCCACTGTGACC
CTTCTGCGCAGTGAGCGGCCCCCCATCTTTGAGATCCGAATGTATGATGCCCAGCAGCAG
CAAGTTGGCACCAACAAATGCCGGGTGAACAATGGCGGCTGCAGCAGCCTGTGCTTGGCC
ACCCCTGGGAGCCGCCAGTGCGCCTGTGCTGAGGACCAGGTGTTGGACGCAGACGGCGTC
ACTTGCTTGGCGAACCCATCCTACGTGCCTCCACCCCAGTGCCAGCCAGGCGAGTTTGCC
TGTGCCAACAGCCGCTGCATCCAGGAGCGCTGGAAGTGTGACGGAGACAACGATTGCCTG
GACAACAGTGATGAGGCCCCAGCCCTCTGCCATCAGCACACCTGCCCCTCGGACCGATTC
AAGTGCGAGAACAACCGGTGCATCCCCAACCGCTGGCTCTGCGACGGGGACAATGACTGT
GGGAACAGTGAAGATGAGTCCAATGCCACTTGTTCAGCCCGCACCTGCCCCCCCAACCAG
TTCTCCTGTGCCAGTGGCCGCTGCATCCCCATCTCCTGGACGTGTGATCTGGATGACGAC
TGTGGGGACCGCTCTGATGAGTCTGCTTCGTGTGCCTATCCCACCTGCTTCCCCCTGACT
CAGTTTACCTGCAACAATGGCAGATGTATCAACATCAACTGGAGATGCGACAATGACAAT
GACTGTGGGGACAACAGTGACGAAGCCGGCTGCAGCCACTCCTGTTCTAGCACCCAGTTC
AAGTGCAACAGCGGGCGTTGCATCCCCGAGCACTGGACCTGCGATGGGGACAATGACTGC
GGAGACTACAGTGATGAGACACACGCCAACTGCACCAACCAGGCCACGAGGCCCCCTGGT
GGCTGCCACACTGATGAGTTCCAGTGCCGGCTGGATGGACTATGCATCCCCCTGCGGTGG
CGCTGCGATGGGGACACTGACTGCATGGACTCCAGCGATGAGAAGAGCTGTGAGGGAGTG
ACCCACGTCTGCGATCCCAGTGTCAAGTTTGGCTGCAAGGACTCAGCTCGGTGCATCAGC
AAAGCGTGGGTGTGTGATGGCGACAATGACTGTGAGGATAACTCGGACGAGGAGAACTGC
GAGTCCCTGGCCTGCAGGCCACCCTCGCACCCTTGTGCCAACAACACCTCAGTCTGCCTG
CCCCCTGACAAGCTGTGTGATGGCAACGACGACTGTGGCGACGGCTCAGATGAGGGCGAG
CTCTGCGACCAGTGCTCTCTGAATAACGGTGGCTGCAGCCACAACTGCTCAGTGGCACCT
GGCGAAGGCATTGTGTGTTCCTGCCCTCTGGGCATGGAGCTGGGGCCCGACAACCACACC
TGCCAGATCCAGAGCTACTGTGCCAAGCATCTCAAATGCAGCCAAAAGTGCGACCAGAAC
AAGTTCAGCGTGAAGTGCTCCTGCTACGAGGGCTGGGTCCTGGAACCTGACGGCGAGAGC
TGCCGCAGCCTGGACCCCTTCAAGCCGTTCATCATTTTCTCCAACCGCCATGAAATCCGG
CGCATCGATCTTCACAAAGGAGACTACAGCGTCCTGGTGCCCGGCCTGCGCAACACCATC
GCCCTGGACTTCCACCTCAGCCAGAGCGCCCTCTACTGGACCGACGTGGTGGAGGACAAG
ATCTACCGCGGGAAGCTGCTGGACAACGGAGCCCTGACTAGTTTCGAGGTGGTGATTCAG
TATGGCCTGGCCACACCCGAGGGCCTGGCTGTAGACTGGATTGCAGGCAACATCTACTGG
GTGGAGAGTAACCTGGATCAGATCGAGGTGGCCAAGCTGGATGGGACCCTCCGGACCACC
CTGCTGGCCGGTGACATTGAGCACCCAAGGGCAATCGCACTGGATCCCCGGGATGGGATC
CTGTTTTGGACAGACTGGGATGCCAGCCTGCCCCGCATTGAGGCAGCCTCCATGAGTGGG
GCTGGGCGCCGCACCGTGCACCGGGAGACCGGCTCTGGGGGCTGGCCCAACGGGCTCACC
GTGGACTACCTGGAGAAGCGCATCCTTTGGATTGACGCCAGGTCAGATGCCATTTACTCA
GCCCGTTACGACGGCTCTGGCCACATGGAGGTGCTTCGGGGACACGAGTTCCTGTCGCAC
CCGTTTGCAGTGACGCTGTACGGGGGGGAGGTCTACTGGACTGACTGGCGAACAAACACA
CTGGCTAAGGCCAACAAGTGGACCGGCCACAATGTCACCGTGGTACAGAGGACCAACACC
CAGCCCTTTGACCTGCAGGTGTACCACCCCTCCCGCCAGCCCATGGCTCCCAATCCCTGT
GAGGCCAATGGGGGCCAGGGCCCCTGCTCCCACCTGTGTCTCATCAACTACAACCGGACC
GTGTCCTGCGCCTGCCCCCACCTCATGAAGCTCCACAAGGACAACACCACCTGCTATGAG
TTTAAGAAGTTCCTGCTGTACGCACGTCAGATGGAGATCCGAGGTGTGGACCTGGATGCT
CCCTACTACAACTACATCATCTCCTTCACGGTGCCCGACATCGACAACGTCACAGTGCTA
GACTACGATGCCCGCGAGCAGCGTGTGTACTGGTCTGACGTGCGGACACAGGCCATCAAG
CGGGCCTTCATCAACGGCACAGGCGTGGAGACAGTCGTCTCTGCAGACTTGCCAAATGCC
CACGGGCTGGCTGTGGACTGGGTCTCCCGAAACCTGTTCTGGACAAGCTATGACACCAAT
AAGAAGCAGATCAATGTGGCCCGGCTGGATGGCTCCTTCAAGAACGCAGTGGTGCAGGGC
CTGGAGCAGCCCCATGGCCTTGTCGTCCACCCTCTGCGTGGGAAGCTCTACTGGACCGAT
GGTGACAACATCAGCATGGCCAACATGGATGGCAGCAATCGCACCCTGCTCTTCAGTGGC
CAGAAGGGCCCCGTGGGCCTGGCTATTGACTTCCCTGAAAGCAAACTCTACTGGATCAGC
TCCGGGAACCATACCATCAACCGCTGCAACCTGGATGGGAGTGGGCTGGAGGTCATCGAT
GCCATGCGGAGCCAGCTGGGCAAGGCCACCGCCCTGGCCATCATGGGGGACAAGCTGTGG
TGGGCTGATCAGGTGTCGGAAAAGATGGGCACATGCAGCAAGGCTGACGGCTCGGGCTCC
GTGGTCCTTCGGAACAGCACCACCCTGGTGATGCACATGAAGGTCTATGACGAGAGCATC
CAGCTGGACCATAAGGGCACCAACCCCTGCAGTGTCAACAACGGTGACTGCTCCCAGCTC
TGCCTGCCCACGTCAGAGACGACCCGCTCCTGCATGTGCACAGCCGGCTATAGCCTCCGG
AGTGGCCAGCAGGCCTGCGAGGGCGTAGGTTCCTTTCTCCTGTACTCTGTGCATGAGGGA
ATCAGGGGAATTCCCCTGGATCCCAATGACAAGTCAGATGCCCTGGTCCCAGTGTCCGGG
ACCTCGCTGGCTGTCGGCATCGACTTCCACGCTGAAAATGACACCATCTACTGGGTGGAC
ATGGGCCTGAGCACGATCAGCCGGGCCAAGCGGGACCAGACGTGGCGTGAAGACGTGGTG
ACCAATGGCATTGGCCGTGTGGAGGGCATTGCAGTGGACTGGATCGCAGGCAACATCTAC
TGGACAGACCAGGGCTTTGATGTCATCGAGGTCGCCCGGCTCAATGGCTCCTTCCGCTAC
GTGGTGATCTCCCAGGGTCTAGACAAGCCCCGGGCCATCACCGTCCACCCGGAGAAAGGG
TACTTGTTCTGGACTGAGTGGGGTCAGTATCCGCGTATTGAGCGGTCTCGGCTAGATGGC
ACGGAGCGTGTGGTGCTGGTCAACGTCAGCATCAGCTGGCCCAACGGCATCTCAGTGGAC
TACCAGGATGGGAAGCTGTACTGGTGCGATGCACGGACAGACAAGATTGAACGGATCGAC
CTGGAGACAGGTGAGAACCGCGAGGTGGTTCTGTCCAGCAACAACATGGACATGTTTTCA
GTGTCTGTGTTTGAGGATTTCATCTACTGGAGTGACAGGACTCATGCCAACGGCTCTATC
AAGCGCGGGAGCAAAGACAATGCCACAGACTCCGTGCCCCTGCGAACCGGCATCGGCGTC
CAGCTTAAAGACATCAAAGTCTTCAACCGGGACCGGCAGAAAGGCACCAACGTGTGCGCG
GTGGCCAATGGCGGGTGCCAGCAGCTGTGCCTGTACCGGGGCCGTGGGCAGCGGGCCTGC
GCCTGTGCCCACGGGATGCTGGCTGAAGACGGAGCATCGTGCCGCGAGTATGCCGGCTAC
CTGCTCTACTCAGAGCGCACCATTCTCAAGAGTATCCACCTGTCGGATGAGCGCAACCTC
AATGCGCCCGTGCAGCCCTTCGAGGACCCTGAGCACATGAAGAACGTCATCGCCCTGGCC
TTTGACTACCGGGCAGGCACCTCTCCGGGCACCCCCAATCGCATCTTCTTCAGCGACATC
CACTTTGGGAACATCCAACAGATCAACGACGATGGCTCCAGGAGGATCACCATTGTGGAA
AACGTGGGCTCCGTGGAAGGCCTGGCCTATCACCGTGGCTGGGACACTCTCTATTGGACA
AGCTACACGACATCCACCATCACGCGCCACACAGTGGACCAGACCCGCCCAGGGGCCTTC
GAGCGTGAGACCGTCATCACTATGTCTGGAGATGACCACCCACGGGCCTTCGTTTTGGAC
GAGTGCCAGAACCTCATGTTCTGGACCAACTGGAATGAGCAGCATCCCAGCATCATGCGG
GCGGCGCTCTCGGGAGCCAATGTCCTGACCCTTATCGAGAAGGACATCCGTACCCCCAAT
GGCCTGGCCATCGACCACCGTGCCGAGAAGCTCTACTTCTCTGACGCCACCCTGGACAAG
ATCGAGCGGTGCGAGTATGACGGCTCCCACCGCTATGTGATCCTAAAGTCAGAGCCTGTC
CACCCCTTCGGGCTGGCCGTGTATGGGGAGCACATTTTCTGGACTGACTGGGTGCGGCGG
GCAGTGCAGCGGGCCAACAAGCACGTGGGCAGCAACATGAAGCTGCTGCGCGTGGACATC
CCCCAGCAGCCCATGGGCATCATCGCCGTGGCCAACGACACCAACAGCTGTGAACTCTCT
CCATGCCGAATCAACAACGGTGGCTGCCAGGACCTGTGTCTGCTCACTCACCAGGGCCAT
GTCAACTGCTCATGCCGAGGGGGCCGAATCCTCCAGGATGACCTCACCTGCCGAGCGGTG
AATTCCTCTTGCCGAGCACAAGATGAGTTTGAGTGTGCCAATGGCGAGTGCATCAACTTC
AGCCTGACCTGCGACGGCGTCCCCCACTGCAAGGACAAGTCCGATGAGAAGCCATCCTAC
TGCAACTCCCGCCGCTGCAAGAAGACTTTCCGGCAGTGCAGCAATGGGCGCTGTGTGTCC
AACATGCTGTGGTGCAACGGGGCCGACGACTGTGGGGATGGCTCTGACGAGATCCCTTGC
AACAAGACAGCCTGTGGTGTGGGCGAGTTCCGCTGCCGGGACGGGACCTGCATCGGGAAC
TCCAGCCGCTGCAACCAGTTTGTGGATTGTGAGGACGCCTCAGATGAGATGAACTGCAGT
GCCACCGACTGCAGCAGCTACTTCCGCCTGGGCGTGAAGGGCGTGCTCTTCCAGCCCTGC
GAGCGGACCTCACTCTGCTACGCACCCAGCTGGGTGTGTGATGGCGCCAATGACTGTGGG
GACTACAGTGATGAGCGCGACTGCCCAGGTGTGAAACGCCCCAGATGCCCTCTGAATTAC
TTCGCCTGCCCTAGTGGGCGCTGCATCCCCATGAGCTGGACGTGTGACAAAGAGGATGAC
TGTGAACATGGCGAGGACGAGACCCACTGCAACAAGTTCTGCTCAGAGGCCCAGTTTGAG
TGCCAGAACCATCGCTGCATCTCCAAGCAGTGGCTGTGTGACGGCAGCGATGACTGTGGG
GATGGCTCAGACGAGGCTGCTCACTGTGAAGGCAAGACGTGCGGCCCCTCCTCCTTCTCC
TGCCCTGGCACCCACGTGTGCGTCCCCGAGCGCTGGCTCTGTGACGGTGACAAAGACTGT
GCTGATGGTGCAGACGAGAGCATCGCAGCTGGTTGCTTGTACAACAGCACTTGTGACGAC
CGTGAGTTCATGTGCCAGAACCGCCAGTGCATCCCCAAGCACTTCGTGTGTGACCACGAC
CGTGACTGTGCAGATGGCTCTGATGAGTCCCCCGAGTGTGAGTACCCGACCTGCGGCCCC
AGTGAGTTCCGCTGTGCCAATGGGCGCTGTCTGAGCTCCCGCCAGTGGGAGTGTGATGGC
GAGAATGACTGCCACGACCAGAGTGACGAGGCTCCCAAGAACCCACACTGCACCAGCCAA
GAGCACAAGTGCAATGCCTCGTCACAGTTCCTGTGCAGCAGTGGGCGCTGTGTGGCTGAG
GCACTGCTCTGCAACGGCCAGGATGACTGTGGCGACAGCTCGGACGAGCGTGGCTGCCAC
ATCAATGAGTGTCTCAGCCGCAAGCTCAGTGGCTGCAGCCAGGACTGTGAGGACCTCAAG
ATCGGCTTCAAGTGCCGCTGTCGCCCTGGCTTCCGGCTGAAGGACGACGGCCGGACGTGT
GCTGATGTGGACGAGTGCAGCACCACCTTCCCCTGCAGCCAGCGCTGCATCAACACTCAT
GGCAGCTATAAGTGTCTGTGTGTGGAGGGCTATGCACCCCGCGGCGGCGACCCCCACAGC
TGCAAGGCTGTGACTGACGAGGAACCGTTTCTGATCTTCGCCAACCGGTACTACCTGCGC
AAGCTCAACCTGGACGGGTCCAACTACACGTTACTTAAGCAGGGCCTGAACAACGCCGTT
GCCTTGGATTTTGACTACCGAGAGCAGATGATCTACTGGACAGATGTGACCACCCAGGGC
AGCATGATCCGAAGGATGCACCTTAACGGGAGCAATGTGCAGGTCCTACACCGTACAGGC
CTCAGCAACCCCGATGGGCTGGCTGTGGACTGGGTGGGTGGCAACCTGTACTGGTGCGAC
AAAGGCCGGGACACCATCGAGGTGTCCAAGCTCAATGGGGCCTATCGGACGGTGCTGGTC
AGCTCTGGCCTCCGTGAGCCCAGGGCTCTGGTGGTGGATGTGCAGAATGGGTACCTGTAC
TGGACAGACTGGGGTGACCATTCACTGATCGGCCGCATCGGCATGGATGGGTCCAGCCGC
AGCGTCATCGTGGACACCAAGATCACATGGCCCAATGGCCTGACGCTGGACTATGTCACT
GAGCGCATCTACTGGGCCGACGCCCGCGAGGACTACATTGAATTTGCCAGCCTGGATGGC
TCCAATCGCCACGTTGTGCTGAGCCAGGACATCCCGCACATCTTTGCACTGACCCTGTTT
GAGGACTACGTCTACTGGACCGACTGGGAAACAAAGTCCATTAACCGAGCCCACAAGACC
ACGGGCACCAACAAAACGCTCCTCATCAGCACGCTGCACCGGCCCATGGACCTGCATGTC
TTCCATGCCCTGCGCCAGCCAGACGTGCCCAATCACCCCTGCAAGGTCAACAATGGTGGC
TGCAGCAACCTGTGCCTGCTGTCCCCCGGGGGAGGGCACAAATGTGCCTGCCCCACCAAC
TTCTACCTGGGCAGCGATGGGCGCACCTGTGTGTCCAACTGCACGGCTAGCCAGTTTGTA
TGCAAGAACGACAAGTGCATCCCCTTCTGGTGGAAGTGTGACACCGAGGACGACTGCGGG
GACCACTCAGACGAGCCCCCGGACTGCCCTGAGTTCAAGTGCCGGCCCGGACAGTTCCAG
TGCTCCACAGGTATCTGCACAAACCCTGCCTTCATCTGCGATGGCGACAATGACTGCCAG
GACAACAGTGACGAGGCCAACTGTGACATCCACGTCTGCTTGCCCAGTCAGTTCAAATGC
ACCAACACCAACCGCTGTATTCCCGGCATCTTCCGCTGCAATGGGCAGGACAACTGCGGA
GATGGGGAGGATGAGAGGGACTGCCCCGAGGTGACCTGCGCCCCCAACCAGTTCCAGTGC
TCCATTACCAAACGGTGCATCCCCCGGGTCTGGGTCTGCGACCGGGACAATGACTGTGTG
GATGGCAGTGATGAGCCCGCCAACTGCACCCAGATGACCTGTGGTGTGGACGAGTTCCGC
TGCAAGGATTCGGGCCGCTGCATCCCAGCGCGTTGGAAGTGTGACGGAGAGGATGACTGT
GGGGATGGCTCGGATGAGCCCAAGGAAGAGTGTGATGAACGCACCTGTGAGCCATACCAG
TTCCGCTGCAAGAACAACCGCTGCGTGCCCGGCCGCTGGCAGTGCGACTACGACAACGAT
TGCGGTGACAACTCCGATGAAGAGAGCTGCACCCCTCGGCCCTGCTCCGAGAGTGAGTTC
TCCTGTGCCAACGGCCGCTGCATCGCGGGGCGCTGGAAATGCGATGGAGACCACGACTGC
GCGGACGGCTCGGACGAGAAAGACTGCACCCCCCGCTGTGACATGGACCAGTTCCAGTGC
AAGAGCGGCCACTGCATCCCCCTGCGCTGGCGCTGTGACGCAGACGCCGACTGCATGGAC
GGCAGCGACGAGGAGGCCTGCGGCACTGGCGTGCGGACCTGCCCCCTGGACGAGTTCCAG
TGCAACAACACCTTGTGCAAGCCGCTGGCCTGGAAGTGCGATGGCGAGGATGACTGTGGG
GACAACTCAGATGAGAACCCCGAGGAGTGTGCCCGGTTCGTGTGCCCTCCCAACCGGCCC
TTCCGTTGCAAGAATGACCGCGTCTGTCTGTGGATCGGGCGCCAATGCGATGGCACGGAC
AACTGTGGGGATGGGACTGATGAAGAGGACTGTGAGCCCCCCACAGCCCACACCACCCAC
TGCAAAGACAAGAAGGAGTTTCTGTGCCGGAACCAGCGCTGCCTCTCCTCCTCCCTGCGC
TGCAACATGTTCGATGACTGCGGGGACGGCTCTGACGAGGAGGACTGCAGCATCGACCCC
AAGCTGACCAGCTGCGCCACCAATGCCAGCATCTGTGGGGACGAGGCACGCTGCGTGCGC
ACCGAGAAAGCGGCCTACTGTGCCTGCCGCTCGGGCTTCCACACCGTGCCCGGCCAGCCC
GGATGCCAAGACATCAACGAGTGCCTGCGCTTCGGCACCTGCTCCCAGCTCTGCAACAAC
ACCAAGGGCGGCCACCTCTGCAGCTGCGCTCGGAACTTCATGAAGACGCACAACACCTGC
AAGGCCGAAGGCTCTGAGTACCAGGTCCTGTACATCGCTGATGACAATGAGATCCGCAGC
CTGTTCCCCGGCCACCCCCATTCGGCTTACGAGCAGGCATTCCAGGGTGACGAGAGTGTC
CGCATTGATGCTATGGATGTCCATGTCAAGGCTGGCCGTGTCTATTGGACCAACTGGCAC
ACGGGCACCATCTCCTACCGCAGCCTGCCACCTGCTGCGCCTCCTACCACTTCCAACCGC
CACCGGCGACAGATTGACCGGGGTGTCACCCACCTCAACATTTCAGGGCTGAAGATGCCC
AGAGGCATCGCCATCGACTGGGTGGCCGGAAACGTGTACTGGACCGACTCGGGCCGAGAT
GTGATTGAGGTGGCGCAGATGAAGGGCGAGAACCGCAAGACGCTCATCTCGGGCATGATT
GACGAGCCCCACGCCATTGTGGTGGACCCACTGAGGGGGACCATGTACTGGTCAGACTGG
GGCAACCACCCCAAGATTGAGACGGCAGCGATGGATGGGACGCTTCGGGAGACACTGGTG
CAGGACAACATTCAGTGGCCCACAGGCCTGGCCGTGGATTATCACAATGAGCGGCTGTAC
TGGGCAGACGCCAAGCTTTCAGTCATCGGCAGCATCCGGCTCAATGGCACGGACCCCATT
GTGGCTGCTGACAGCAAACGAGGCCTAAGTCACCCCTTCAGCATCGACGTCTTTGAGGAT
TACATCTATGGTGTCACCTACATCAATAATCGTGTCTTCAAGATCCATAAGTTTGGCCAC
AGCCCCTTGGTCAACCTGACAGGGGGCCTGAGCCACGCCTCTGACGTGGTCCTTTACCAT
CAGCACAAGCAGCCCGAAGTGACCAACCCATGTGACCGCAAGAAATGCGAGTGGCTCTGC
CTGCTGAGCCCCAGTGGGCCTGTCTGCACCTGTCCCAATGGGAAGCGGCTGGACAACGGC
ACATGCGTGCCTGTGCCCTCTCCAACGCCCCCCCCAGATGCTCCCCGGCCTGGAACCTGT
AACCTGCAGTGCTTCAACGGTGGCAGCTGTTTCCTCAATGCACGGAGGCAGCCCAAGTGC
CGCTGCCAACCCCGCTACACGGGTGACAAGTGTGAACTGGACCAGTGCTGGGAGCACTGT
CGCAATGGGGGCACCTGTGCTGCCTCCCCCTCTGGCATGCCCACGTGCCGGTGCCCCACG
GGCTTCACGGGCCCCAAATGCACCCAGCAGGTGTGTGCGGGCTACTGTGCCAACAACAGC
ACCTGCACTGTCAACCAGGGCAACCAGCCCCAGTGCCGATGCCTACCCGGCTTCCTGGGC
GACCGCTGCCAGTACCGGCAGTGCTCTGGCTACTGTGAGAACTTTGGCACATGCCAGATG
GCTGCTGATGGCTCCCGACAATGCCGCTGCACTGCCTACTTTGAGGGATCGAGGTGTGAG
GTGAACAAGTGCAGCCGCTGTCTCGAAGGGGCCTGTGTGGTCAACAAGCAGAGTGGGGAT
GTCACCTGCAACTGCACGGATGGCCGGGTGGCCCCCAGCTGTCTGACCTGCGTCGGCCAC
TGCAGCAATGGCGGCTCCTGTACCATGAACAGCAAAATGATGCCTGAGTGCCAGTGCCCA
CCCCACATGACAGGGCCCCGGTGTGAGGAGCACGTCTTCAGCCAGCAGCAGCCAGGACAT
ATAGCCTCCATCCTAATCCCTCTGCTGTTGCTGCTGCTGCTGGTTCTGGTGGCCGGAGTG
GTATTCTGGTATAAGCGGCGAGTCCAAGGGGCTAAGGGCTTCCAGCACCAACGGATGACC
AACGGGGCCATGAACGTGGAGATTGGAAACCCCACCTACAAGATGTACGAAGGCGGAGAG
CCTGATGATGTGGGAGGCCTACTGGACGCTGACTTTGCCCTGGACCCTGACAAGCCCACC
AACTTCACCAACCCCGTGTATGCCACACTCTACATGGGGGGCCATGGCAGTCGCCACTCC
CTGGCCAGCACGGACGAGAAGCGAGAACTCCTGGGCCGGGGCCCTGAGGACGAGATAGGG
GACCCCTTGGCATAG
Chromosome Location
12
Locus
12q13-q14
External Identifiers
ResourceLink
UniProtKB IDQ07954
UniProtKB Entry NameLRP1_HUMAN
GenBank Protein ID34339
GenBank Gene IDX13916
GenAtlas IDLRP1
HGNC IDHGNC:6692
General References
  1. Herz J, Hamann U, Rogne S, Myklebost O, Gausepohl H, Stanley KK: Surface location and high affinity for calcium of a 500-kd liver membrane protein closely related to the LDL-receptor suggest a physiological role as lipoprotein receptor. EMBO J. 1988 Dec 20;7(13):4119-27. [PubMed:3266596]
  2. Van Leuven F, Stas L, Hilliker C, Lorent K, Umans L, Serneels L, Overbergh L, Torrekens S, Moechars D, De Strooper B, et al.: Structure of the gene (LRP1) coding for the human alpha 2-macroglobulin receptor lipoprotein receptor-related protein. Genomics. 1994 Nov 1;24(1):78-89. [PubMed:7534747]
  3. Van Leuven F, Stas L, Thiry E, Nelissen B, Miyake Y: Strategy to sequence the 89 exons of the human LRP1 gene coding for the lipoprotein receptor related protein: identification of one expressed mutation among 48 polymorphisms. Genomics. 1998 Sep 1;52(2):138-44. [PubMed:9782078]
  4. Scherer SE, Muzny DM, Buhay CJ, Chen R, Cree A, Ding Y, Dugan-Rocha S, Gill R, Gunaratne P, Harris RA, Hawes AC, Hernandez J, Hodgson AV, Hume J, Jackson A, Khan ZM, Kovar-Smith C, Lewis LR, Lozado RJ, Metzker ML, Milosavljevic A, Miner GR, Montgomery KT, Morgan MB, Nazareth LV, Scott G, Sodergren E, Song XZ, Steffen D, Lovering RC, Wheeler DA, Worley KC, Yuan Y, Zhang Z, Adams CQ, Ansari-Lari MA, Ayele M, Brown MJ, Chen G, Chen Z, Clerc-Blankenburg KP, Davis C, Delgado O, Dinh HH, Draper H, Gonzalez-Garay ML, Havlak P, Jackson LR, Jacob LS, Kelly SH, Li L, Li Z, Liu J, Liu W, Lu J, Maheshwari M, Nguyen BV, Okwuonu GO, Pasternak S, Perez LM, Plopper FJ, Santibanez J, Shen H, Tabor PE, Verduzco D, Waldron L, Wang Q, Williams GA, Zhang J, Zhou J, Allen CC, Amin AG, Anyalebechi V, Bailey M, Barbaria JA, Bimage KE, Bryant NP, Burch PE, Burkett CE, Burrell KL, Calderon E, Cardenas V, Carter K, Casias K, Cavazos I, Cavazos SR, Ceasar H, Chacko J, Chan SN, Chavez D, Christopoulos C, Chu J, Cockrell R, Cox CD, Dang M, Dathorne SR, David R, Davis CM, Davy-Carroll L, Deshazo DR, Donlin JE, D'Souza L, Eaves KA, Egan A, Emery-Cohen AJ, Escotto M, Flagg N, Forbes LD, Gabisi AM, Garza M, Hamilton C, Henderson N, Hernandez O, Hines S, Hogues ME, Huang M, Idlebird DG, Johnson R, Jolivet A, Jones S, Kagan R, King LM, Leal B, Lebow H, Lee S, LeVan JM, Lewis LC, London P, Lorensuhewa LM, Loulseged H, Lovett DA, Lucier A, Lucier RL, Ma J, Madu RC, Mapua P, Martindale AD, Martinez E, Massey E, Mawhiney S, Meador MG, Mendez S, Mercado C, Mercado IC, Merritt CE, Miner ZL, Minja E, Mitchell T, Mohabbat F, Mohabbat K, Montgomery B, Moore N, Morris S, Munidasa M, Ngo RN, Nguyen NB, Nickerson E, Nwaokelemeh OO, Nwokenkwo S, Obregon M, Oguh M, Oragunye N, Oviedo RJ, Parish BJ, Parker DN, Parrish J, Parks KL, Paul HA, Payton BA, Perez A, Perrin W, Pickens A, Primus EL, Pu LL, Puazo M, Quiles MM, Quiroz JB, Rabata D, Reeves K, Ruiz SJ, Shao H, Sisson I, Sonaike T, Sorelle RP, Sutton AE, Svatek AF, Svetz LA, Tamerisa KS, Taylor TR, Teague B, Thomas N, Thorn RD, Trejos ZY, Trevino BK, Ukegbu ON, Urban JB, Vasquez LI, Vera VA, Villasana DM, Wang L, Ward-Moore S, Warren JT, Wei X, White F, Williamson AL, Wleczyk R, Wooden HS, Wooden SH, Yen J, Yoon L, Yoon V, Zorrilla SE, Nelson D, Kucherlapati R, Weinstock G, Gibbs RA: The finished DNA sequence of human chromosome 12. Nature. 2006 Mar 16;440(7082):346-51. [PubMed:16541075]
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  6. Kutt H, Herz J, Stanley KK: Structure of the low-density lipoprotein receptor-related protein (LRP) promoter. Biochim Biophys Acta. 1989 Dec 22;1009(3):229-36. [PubMed:2597675]
  7. Strickland DK, Ashcom JD, Williams S, Burgess WH, Migliorini M, Argraves WS: Sequence identity between the alpha 2-macroglobulin receptor and low density lipoprotein receptor-related protein suggests that this molecule is a multifunctional receptor. J Biol Chem. 1990 Oct 15;265(29):17401-4. [PubMed:1698775]
  8. Herz J, Kowal RC, Goldstein JL, Brown MS: Proteolytic processing of the 600 kd low density lipoprotein receptor-related protein (LRP) occurs in a trans-Golgi compartment. EMBO J. 1990 Jun;9(6):1769-76. [PubMed:2112085]
  9. Kristensen T, Moestrup SK, Gliemann J, Bendtsen L, Sand O, Sottrup-Jensen L: Evidence that the newly cloned low-density-lipoprotein receptor related protein (LRP) is the alpha 2-macroglobulin receptor. FEBS Lett. 1990 Dec 10;276(1-2):151-5. [PubMed:1702392]
  10. Kounnas MZ, Morris RE, Thompson MR, FitzGerald DJ, Strickland DK, Saelinger CB: The alpha 2-macroglobulin receptor/low density lipoprotein receptor-related protein binds and internalizes Pseudomonas exotoxin A. J Biol Chem. 1992 Jun 25;267(18):12420-3. [PubMed:1618748]
  11. Su HP, Nakada-Tsukui K, Tosello-Trampont AC, Li Y, Bu G, Henson PM, Ravichandran KS: Interaction of CED-6/GULP, an adapter protein involved in engulfment of apoptotic cells with CED-1 and CD91/low density lipoprotein receptor-related protein (LRP). J Biol Chem. 2002 Apr 5;277(14):11772-9. Epub 2001 Nov 29. [PubMed:11729193]
  12. Loukinova E, Ranganathan S, Kuznetsov S, Gorlatova N, Migliorini MM, Loukinov D, Ulery PG, Mikhailenko I, Lawrence DA, Strickland DK: Platelet-derived growth factor (PDGF)-induced tyrosine phosphorylation of the low density lipoprotein receptor-related protein (LRP). Evidence for integrated co-receptor function betwenn LRP and the PDGF. J Biol Chem. 2002 May 3;277(18):15499-506. Epub 2002 Feb 19. [PubMed:11854294]
  13. May P, Reddy YK, Herz J: Proteolytic processing of low density lipoprotein receptor-related protein mediates regulated release of its intracellular domain. J Biol Chem. 2002 May 24;277(21):18736-43. Epub 2002 Mar 20. [PubMed:11907044]
  14. Kinoshita A, Shah T, Tangredi MM, Strickland DK, Hyman BT: The intracellular domain of the low density lipoprotein receptor-related protein modulates transactivation mediated by amyloid precursor protein and Fe65. J Biol Chem. 2003 Oct 17;278(42):41182-8. Epub 2003 Jul 29. [PubMed:12888553]
  15. May P, Herz J: LDL receptor-related proteins in neurodevelopment. Traffic. 2003 May;4(5):291-301. [PubMed:12713657]
  16. Ranganathan S, Liu CX, Migliorini MM, Von Arnim CA, Peltan ID, Mikhailenko I, Hyman BT, Strickland DK: Serine and threonine phosphorylation of the low density lipoprotein receptor-related protein by protein kinase Calpha regulates endocytosis and association with adaptor molecules. J Biol Chem. 2004 Sep 24;279(39):40536-44. Epub 2004 Jul 22. [PubMed:15272003]
  17. Knauth P, Schluter T, Czubayko M, Kirsch C, Florian V, Schreckenberger S, Hahn H, Bohnensack R: Functions of sorting nexin 17 domains and recognition motif for P-selectin trafficking. J Mol Biol. 2005 Apr 8;347(4):813-25. [PubMed:15769472]
  18. Liu T, Qian WJ, Gritsenko MA, Camp DG 2nd, Monroe ME, Moore RJ, Smith RD: Human plasma N-glycoproteome analysis by immunoaffinity subtraction, hydrazide chemistry, and mass spectrometry. J Proteome Res. 2005 Nov-Dec;4(6):2070-80. [PubMed:16335952]
  19. Caratu G, Allegra D, Bimonte M, Schiattarella GG, D'Ambrosio C, Scaloni A, Napolitano M, Russo T, Zambrano N: Identification of the ligands of protein interaction domains through a functional approach. Mol Cell Proteomics. 2007 Feb;6(2):333-45. Epub 2006 Nov 23. [PubMed:17124247]
  20. Chen R, Jiang X, Sun D, Han G, Wang F, Ye M, Wang L, Zou H: Glycoproteomics analysis of human liver tissue by combination of multiple enzyme digestion and hydrazide chemistry. J Proteome Res. 2009 Feb;8(2):651-61. doi: 10.1021/pr8008012. [PubMed:19159218]
  21. Jia W, Lu Z, Fu Y, Wang HP, Wang LH, Chi H, Yuan ZF, Zheng ZB, Song LN, Han HH, Liang YM, Wang JL, Cai Y, Zhang YK, Deng YL, Ying WT, He SM, Qian XH: A strategy for precise and large scale identification of core fucosylated glycoproteins. Mol Cell Proteomics. 2009 May;8(5):913-23. doi: 10.1074/mcp.M800504-MCP200. Epub 2009 Jan 12. [PubMed:19139490]
  22. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [PubMed:21269460]
  23. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [PubMed:24275569]
  24. Huang W, Dolmer K, Gettins PG: NMR solution structure of complement-like repeat CR8 from the low density lipoprotein receptor-related protein. J Biol Chem. 1999 May 14;274(20):14130-6. [PubMed:10318830]
  25. Dolmer K, Huang W, Gettins PG: NMR solution structure of complement-like repeat CR3 from the low density lipoprotein receptor-related protein. Evidence for specific binding to the receptor binding domain of human alpha(2)-macroglobulin. J Biol Chem. 2000 Feb 4;275(5):3264-9. [PubMed:10652313]
  26. Simonovic M, Dolmer K, Huang W, Strickland DK, Volz K, Gettins PG: Calcium coordination and pH dependence of the calcium affinity of ligand-binding repeat CR7 from the LRP. Comparison with related domains from the LRP and the LDL receptor. Biochemistry. 2001 Dec 18;40(50):15127-34. [PubMed:11735395]
  27. Jensen GA, Andersen OM, Bonvin AM, Bjerrum-Bohr I, Etzerodt M, Thogersen HC, O'Shea C, Poulsen FM, Kragelund BB: Binding site structure of one LRP-RAP complex: implications for a common ligand-receptor binding motif. J Mol Biol. 2006 Sep 29;362(4):700-16. Epub 2006 Jul 15. [PubMed:16938309]
  28. Sjoblom T, Jones S, Wood LD, Parsons DW, Lin J, Barber TD, Mandelker D, Leary RJ, Ptak J, Silliman N, Szabo S, Buckhaults P, Farrell C, Meeh P, Markowitz SD, Willis J, Dawson D, Willson JK, Gazdar AF, Hartigan J, Wu L, Liu C, Parmigiani G, Park BH, Bachman KE, Papadopoulos N, Vogelstein B, Kinzler KW, Velculescu VE: The consensus coding sequences of human breast and colorectal cancers. Science. 2006 Oct 13;314(5797):268-74. Epub 2006 Sep 7. [PubMed:16959974]
  29. de Ligt J, Willemsen MH, van Bon BW, Kleefstra T, Yntema HG, Kroes T, Vulto-van Silfhout AT, Koolen DA, de Vries P, Gilissen C, del Rosario M, Hoischen A, Scheffer H, de Vries BB, Brunner HG, Veltman JA, Vissers LE: Diagnostic exome sequencing in persons with severe intellectual disability. N Engl J Med. 2012 Nov 15;367(20):1921-9. doi: 10.1056/NEJMoa1206524. Epub 2012 Oct 3. [PubMed:23033978]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00025Antihemophilic factor, human recombinantapproved, investigationalunknownmodulatorDetails
DB00031TenecteplaseapprovedunknownDetails
DB00100Coagulation Factor IX (Recombinant)approved, investigationalunknownDetails
DB06245LanoteplaseinvestigationalunknownDetails
DB13152Coagulation Factor IX HumanapprovedunknownDetails
DB13998Lonoctocog alfaapproved, investigationalunknownmodulatorDetails
DB13999Moroctocog alfaapprovedunknownmodulatorDetails