Sodium-dependent phosphate transporter 2

Details

Name
Sodium-dependent phosphate transporter 2
Synonyms
  • Gibbon ape leukemia virus receptor 2
  • GLVR-2
  • GLVR2
  • hPit2
  • Phosphate transporter 2
  • PiT-2
  • PIT2
  • Solute carrier family 20 member 2
Gene Name
SLC20A2
Organism
Humans
Amino acid sequence
>lcl|BSEQ0049436|Sodium-dependent phosphate transporter 2
MAMDEYLWMVILGFIIAFILAFSVGANDVANSFGTAVGSGVVTLRQACILASIFETTGSV
LLGAKVGETIRKGIIDVNLYNETVETLMAGEVSAMVGSAVWQLIASFLRLPISGTHCIVG
STIGFSLVAIGTKGVQWMELVKIVASWFISPLLSGFMSGLLFVLIRIFILKKEDPVPNGL
RALPVFYAATIAINVFSIMYTGAPVLGLVLPMWAIALISFGVALLFAFFVWLFVCPWMRR
KITGKLQKEGALSRVSDESLSKVQEAESPVFKELPGAKANDDSTIPLTGAAGETLGTSEG
TSAGSHPRAAYGRALSMTHGSVKSPISNGTFGFDGHTRSDGHVYHTVHKDSGLYKDLLHK
IHIDRGPEEKPAQESNYRLLRRNNSYTCYTAAICGLPVHATFRAADSSAPEDSEKLVGDT
VSYSKKRLRYDSYSSYCNAVAEAEIEAEEGGVEMKLASELADPDQPREDPAEEEKEEKDA
PEVHLLFHFLQVLTACFGSFAHGGNDVSNAIGPLVALWLIYKQGGVTQEAATPVWLLFYG
GVGICTGLWVWGRRVIQTMGKDLTPITPSSGFTIELASAFTVVIASNIGLPVSTTHCKVG
SVVAVGWIRSRKAVDWRLFRNIFVAWFVTVPVAGLFSAAVMALLMYGILPYV
Number of residues
652
Molecular Weight
70391.755
Theoretical pI
Not Available
GO Classification
Functions
inorganic phosphate transmembrane transporter activity / receptor activity / sodium / sodium-dependent phosphate transmembrane transporter activity / virus receptor activity
Processes
ion transport / transport
Components
extracellular exosome / integral component of plasma membrane / membrane / plasma membrane
General Function
Virus receptor activity
Specific Function
Sodium-phosphate symporter which seems to play a fundamental housekeeping role in phosphate transport by absorbing phosphate from interstitial fluid for normal cellular functions such as cellular metabolism, signal transduction, and nucleic acid and lipid synthesis. In vitro, sodium-dependent phosphate uptake is not siginificantly affected by acidic and alkaline conditions, however sodium-independent phosphate uptake occurs at acidic conditions. May play a role in extracellular matrix, cartilage and vascular calcification. Functions as a retroviral receptor and confers human cells susceptibility to infection to amphotropic murine leukemia virus (A-MuLV), 10A1 murine leukemia virus (10A1 MLV) and some feline leukemia virus subgroup B (FeLV-B) variants.
Pfam Domain Function
Transmembrane Regions
6-26 47-67 87-107 110-130 143-163 191-211 214-234 483-503 531-551 572-586 594-609 622-642
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0049437|Sodium-dependent phosphate transporter 2 (SLC20A2)
ATGGCCATGGATGAGTATTTGTGGATGGTCATTTTGGGTTTCATCATAGCTTTCATCTTG
GCCTTTTCTGTTGGTGCAAACGATGTTGCCAACTCCTTTGGTACAGCCGTGGGCTCTGGT
GTGGTGACCTTGAGGCAGGCATGCATTTTAGCTTCAATATTTGAAACCACCGGCTCCGTG
TTACTAGGCGCCAAAGTAGGAGAAACCATTCGCAAAGGTATCATTGACGTGAACCTGTAC
AACGAGACGGTGGAGACTCTCATGGCTGGGGAAGTTAGTGCCATGGTTGGTTCCGCTGTG
TGGCAGCTGATTGCTTCCTTCCTGAGGCTTCCAATCTCAGGAACGCACTGCATTGTGGGT
TCTACTATAGGATTCTCACTGGTCGCAATCGGTACCAAAGGTGTGCAGTGGATGGAGCTT
GTCAAGATTGTTGCTTCTTGGTTTATATCTCCACTGTTGTCTGGTTTCATGTCTGGCCTG
CTGTTTGTACTCATCAGAATTTTCATCTTAAAAAAGGAAGACCCTGTTCCCAATGGCCTC
CGGGCACTCCCAGTATTCTATGCTGCTACCATAGCAATCAATGTCTTTTCCATCATGTAC
ACAGGAGCACCAGTGCTCGGCCTTGTTCTCCCCATGTGGGCCATAGCCCTCATTTCCTTT
GGTGTCGCCCTCCTGTTCGCTTTTTTTGTGTGGCTCTTCGTGTGTCCGTGGATGCGGAGG
AAAATAACAGGCAAATTACAAAAAGAAGGTGCTTTATCACGAGTATCTGACGAAAGCCTC
AGTAAGGTTCAGGAAGCAGAGTCCCCAGTATTTAAAGAGCTACCAGGTGCCAAGGCTAAT
GATGACAGCACCATCCCGCTCACGGGAGCAGCAGGGGAGACACTGGGGACCTCGGAAGGC
ACTTCTGCGGGCAGCCACCCTCGGGCTGCATACGGAAGAGCACTGTCCATGACCCATGGC
TCTGTGAAATCGCCCATCTCCAACGGCACCTTCGGCTTCGACGGCCACACCAGGAGCGAC
GGTCATGTGTACCACACCGTGCACAAAGACTCGGGGCTCTACAAAGATCTGCTGCACAAA
ATCCACATCGACAGGGGCCCCGAGGAGAAGCCAGCCCAGGAAAGCAACTACCGGCTGCTG
CGCCGAAACAACAGTTACACCTGCTACACCGCAGCCATTTGTGGGCTGCCAGTGCACGCC
ACCTTTCGAGCTGCGGACTCATCGGCCCCAGAGGACAGTGAGAAGCTGGTGGGCGACACC
GTGTCCTACTCCAAGAAGAGGCTGCGCTACGACAGCTACTCGAGCTACTGTAACGCGGTG
GCAGAGGCGGAGATCGAGGCGGAGGAGGGCGGCGTGGAGATGAAGCTGGCGTCGGAGCTG
GCCGACCCTGACCAGCCGCGAGAGGACCCTGCAGAGGAGGAGAAGGAGGAGAAGGACGCA
CCCGAGGTTCACCTCCTGTTCCATTTCCTGCAGGTCCTCACCGCCTGTTTCGGGTCCTTT
GCTCACGGCGGCAATGACGTGAGTAATGCCATCGGTCCCCTGGTAGCCTTGTGGCTGATT
TACAAACAAGGCGGGGTAACGCAAGAAGCAGCTACACCCGTCTGGCTGCTGTTTTATGGA
GGAGTTGGAATCTGCACAGGCCTCTGGGTCTGGGGGAGAAGAGTGATCCAGACCATGGGG
AAGGACCTCACTCCCATCACGCCGTCCAGCGGCTTCACGATCGAGCTGGCCTCAGCCTTC
ACAGTGGTGATCGCCTCCAACATCGGGCTTCCAGTCAGCACCACGCACTGTAAGGTGGGC
TCGGTGGTGGCCGTGGGCTGGATCCGCTCCCGCAAGGCTGTGGACTGGCGCCTCTTTCGG
AACATCTTCGTGGCCTGGTTCGTGACCGTCCCTGTGGCTGGGCTGTTCAGCGCTGCTGTC
ATGGCTCTTCTCATGTATGGGATCCTTCCATATGTGTGA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ08357
UniProtKB Entry NameS20A2_HUMAN
HGNC IDHGNC:10947
General References
  1. van Zeijl M, Johann SV, Closs E, Cunningham J, Eddy R, Shows TB, O'Hara B: A human amphotropic retrovirus receptor is a second member of the gibbon ape leukemia virus receptor family. Proc Natl Acad Sci U S A. 1994 Feb 1;91(3):1168-72. [Article]
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [Article]
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
  4. Salaun C, Rodrigues P, Heard JM: Transmembrane topology of PiT-2, a phosphate transporter-retrovirus receptor. J Virol. 2001 Jun;75(12):5584-92. [Article]
  5. Chien ML, Foster JL, Douglas JL, Garcia JV: The amphotropic murine leukemia virus receptor gene encodes a 71-kilodalton protein that is induced by phosphate depletion. J Virol. 1997 Jun;71(6):4564-70. [Article]
  6. Sugai J, Eiden M, Anderson MM, Van Hoeven N, Meiering CD, Overbaugh J: Identification of envelope determinants of feline leukemia virus subgroup B that permit infection and gene transfer to cells expressing human Pit1 or Pit2. J Virol. 2001 Aug;75(15):6841-9. [Article]
  7. Bottger P, Pedersen L: Two highly conserved glutamate residues critical for type III sodium-dependent phosphate transport revealed by uncoupling transport function from retroviral receptor function. J Biol Chem. 2002 Nov 8;277(45):42741-7. Epub 2002 Aug 29. [Article]
  8. Bottger P, Pedersen L: Evolutionary and experimental analyses of inorganic phosphate transporter PiT family reveals two related signature sequences harboring highly conserved aspartic acids critical for sodium-dependent phosphate transport function of human PiT2. FEBS J. 2005 Jun;272(12):3060-74. [Article]
  9. Bottger P, Hede SE, Grunnet M, Hoyer B, Klaerke DA, Pedersen L: Characterization of transport mechanisms and determinants critical for Na+-dependent Pi symport of the PiT family paralogs human PiT1 and PiT2. Am J Physiol Cell Physiol. 2006 Dec;291(6):C1377-87. Epub 2006 Jun 21. [Article]
  10. Gauci S, Helbig AO, Slijper M, Krijgsveld J, Heck AJ, Mohammed S: Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach. Anal Chem. 2009 Jun 1;81(11):4493-501. doi: 10.1021/ac9004309. [Article]
  11. Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M: Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Sci Signal. 2010 Jan 12;3(104):ra3. doi: 10.1126/scisignal.2000475. [Article]
  12. Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S: Toward a comprehensive characterization of a human cancer cell phosphoproteome. J Proteome Res. 2013 Jan 4;12(1):260-71. doi: 10.1021/pr300630k. Epub 2012 Dec 18. [Article]
  13. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [Article]
  14. Wang C, Li Y, Shi L, Ren J, Patti M, Wang T, de Oliveira JR, Sobrido MJ, Quintans B, Baquero M, Cui X, Zhang XY, Wang L, Xu H, Wang J, Yao J, Dai X, Liu J, Zhang L, Ma H, Gao Y, Ma X, Feng S, Liu M, Wang QK, Forster IC, Zhang X, Liu JY: Mutations in SLC20A2 link familial idiopathic basal ganglia calcification with phosphate homeostasis. Nat Genet. 2012 Feb 12;44(3):254-6. doi: 10.1038/ng.1077. [Article]
  15. Lemos RR, Oliveira MF, Oliveira JR: Reporting a new mutation at the SLC20A2 gene in familial idiopathic basal ganglia calcification. Eur J Neurol. 2013 Mar;20(3):e43-4. doi: 10.1111/ene.12044. [Article]
  16. Chen WJ, Yao XP, Zhang QJ, Ni W, He J, Li HF, Liu XY, Zhao GX, Murong SX, Wang N, Wu ZY: Novel SLC20A2 mutations identified in southern Chinese patients with idiopathic basal ganglia calcification. Gene. 2013 Oct 15;529(1):159-62. doi: 10.1016/j.gene.2013.07.071. Epub 2013 Aug 11. [Article]
  17. Hsu SC, Sears RL, Lemos RR, Quintans B, Huang A, Spiteri E, Nevarez L, Mamah C, Zatz M, Pierce KD, Fullerton JM, Adair JC, Berner JE, Bower M, Brodaty H, Carmona O, Dobricic V, Fogel BL, Garcia-Estevez D, Goldman J, Goudreau JL, Hopfer S, Jankovic M, Jauma S, Jen JC, Kirdlarp S, Klepper J, Kostic V, Lang AE, Linglart A, Maisenbacher MK, Manyam BV, Mazzoni P, Miedzybrodzka Z, Mitarnun W, Mitchell PB, Mueller J, Novakovic I, Paucar M, Paulson H, Simpson SA, Svenningsson P, Tuite P, Vitek J, Wetchaphanphesat S, Williams C, Yang M, Schofield PR, de Oliveira JR, Sobrido MJ, Geschwind DH, Coppola G: Mutations in SLC20A2 are a major cause of familial idiopathic basal ganglia calcification. Neurogenetics. 2013 Feb;14(1):11-22. doi: 10.1007/s10048-012-0349-2. Epub 2013 Jan 20. [Article]
  18. Nicolas G, Pottier C, Charbonnier C, Guyant-Marechal L, Le Ber I, Pariente J, Labauge P, Ayrignac X, Defebvre L, Maltete D, Martinaud O, Lefaucheur R, Guillin O, Wallon D, Chaumette B, Rondepierre P, Derache N, Fromager G, Schaeffer S, Krystkowiak P, Verny C, Jurici S, Sauvee M, Verin M, Lebouvier T, Rouaud O, Thauvin-Robinet C, Rousseau S, Rovelet-Lecrux A, Frebourg T, Campion D, Hannequin D: Phenotypic spectrum of probable and genetically-confirmed idiopathic basal ganglia calcification. Brain. 2013 Nov;136(Pt 11):3395-407. doi: 10.1093/brain/awt255. Epub 2013 Sep 24. [Article]
  19. Taglia I, Mignarri A, Olgiati S, Menci E, Petrocelli PL, Breedveld GJ, Scaglione C, Martinelli P, Federico A, Bonifati V, Dotti MT: Primary familial brain calcification: Genetic analysis and clinical spectrum. Mov Disord. 2014 Nov;29(13):1691-5. doi: 10.1002/mds.26053. Epub 2014 Oct 4. [Article]
  20. Yamada M, Tanaka M, Takagi M, Kobayashi S, Taguchi Y, Takashima S, Tanaka K, Touge T, Hatsuta H, Murayama S, Hayashi Y, Kaneko M, Ishiura H, Mitsui J, Atsuta N, Sobue G, Shimozawa N, Inuzuka T, Tsuji S, Hozumi I: Evaluation of SLC20A2 mutations that cause idiopathic basal ganglia calcification in Japan. Neurology. 2014 Feb 25;82(8):705-12. doi: 10.1212/WNL.0000000000000143. Epub 2014 Jan 24. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB09449Sodium phosphate, monobasicapprovednosubstrateDetails
DB11348Calcium PhosphateapprovednosubstrateDetails
DB14481Calcium phosphate dihydrateapprovednoDetails
DB14502Sodium phosphate, dibasicapprovednoDetails
DB14503Sodium phosphate, monobasic, unspecified formapprovednoDetails