Urea transporter 1

Details

Name
Urea transporter 1
Synonyms
  • HUT11
  • JK
  • RACH1
  • Solute carrier family 14 member 1
  • Urea transporter, erythrocyte
  • UT1
  • UTE
Gene Name
SLC14A1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0008543|Urea transporter 1
MEDSPTMVRVDSPTMVRGENQVSPCQGRRCFPKALGYVTGDMKELANQLKDKPVVLQFID
WILRGISQVVFVNNPVSGILILVGLLVQNPWWALTGWLGTVVSTLMALLLSQDRSLIASG
LYGYNATLVGVLMAVFSDKGDYFWWLLLPVCAMSMTCPIFSSALNSMLSKWDLPVFTLPF
NMALSMYLSATGHYNPFFPAKLVIPITTAPNISWSDLSALELLKSIPVGVGQIYGCDNPW
TGGIFLGAILLSSPLMCLHAAIGSLLGIAAGLSLSAPFEDIYFGLWGFNSSLACIAMGGM
FMALTWQTHLLALGCALFTAYLGVGMANFMAEVGLPACTWPFCLATLLFLIMTTKNSNIY
KMPLSKVTYPEENRIFYLQAKKRMVESPL
Number of residues
389
Molecular Weight
42527.93
Theoretical pI
Not Available
GO Classification
Functions
urea channel activity / water transmembrane transporter activity
Processes
transmembrane transport / urea transmembrane transport / urea transport
Components
basolateral plasma membrane / integral component of plasma membrane / intracellular membrane-bounded organelle / nucleolus / plasma membrane
General Function
Water transmembrane transporter activity
Specific Function
Urea channel that facilitates transmembrane urea transport down a concentration gradient. A constriction of the transmembrane channel functions as selectivity filter through which urea is expected to pass in dehydrated form. The rate of urea conduction is increased by hypotonic stress. Plays an important role in the kidney medulla collecting ducts, where it allows rapid equilibration between the lumen of the collecting ducts and the interstitium, and thereby prevents water loss driven by the high concentration of urea in the urine. Facilitates urea transport across erythrocyte membranes. May also play a role in transmembrane water transport, possibly by indirect means.
Pfam Domain Function
Not Available
Transmembrane Regions
91-110 115-137 144-168 173-193 255-274 284-304 309-330 333-353
Cellular Location
Cell membrane
Gene sequence
>lcl|BSEQ0017512|Urea transporter 1 (SLC14A1)
ATGAATGGACGGTCTTTGATTGGCGGCGCTGGTGACGCCCGTCATGGTCCTGTTTGGAAG
GACCCTTTTGGAACTAAAGCTGGTGACGCAGCGCGCAGAGGCATCGCCCGGCTAAGCTTG
GCCCTGGCAGATGGGTCGCAGGAACAGGAGCCAGAGGAAGAGATAGCCATGGAGGACAGC
CCCACTATGGTTAGAGTGGACAGCCCCACTATGGTTAGGGGTGAAAACCAGGTTTCGCCA
TGTCAAGGGAGAAGGTGCTTCCCCAAAGCTCTTGGCTATGTCACCGGTGACATGAAAGAA
CTTGCCAACCAGCTTAAAGACAAACCCGTGGTGCTCCAGTTCATTGACTGGATTCTCCGG
GGCATATCCCAAGTGGTGTTCGTCAACAACCCCGTCAGTGGAATCCTGATTCTGGTAGGA
CTTCTTGTTCAGAACCCCTGGTGGGCTCTCACTGGCTGGCTGGGAACAGTGGTCTCCACT
CTGATGGCCCTCTTGCTCAGCCAGGACAGGTCATTAATAGCATCTGGGCTCTATGGCTAC
AATGCCACCCTGGTGGGAGTACTCATGGCTGTCTTTTCGGACAAGGGAGACTATTTCTGG
TGGCTGTTACTCCCTGTATGTGCTATGTCCATGACTTGCCCAATTTTCTCAAGTGCATTG
AATTCCATGCTCAGCAAATGGGACCTCCCCGTCTTCACCCTCCCTTTCAACATGGCGTTG
TCAATGTACCTTTCAGCCACAGGACATTACAATCCATTCTTTCCAGCCAAACTGGTCATA
CCTATAACTACAGCTCCAAATATCTCCTGGTCTGACCTCAGTGCCCTGGAGTTGTTGAAA
TCTATACCAGTGGGAGTTGGTCAGATCTATGGCTGTGATAATCCATGGACAGGGGGCATT
TTCCTGGGAGCCATCCTACTCTCCTCCCCACTCATGTGCCTGCATGCTGCCATAGGATCA
TTGCTGGGCATAGCAGCGGGACTCAGTCTTTCAGCCCCATTTGAGGACATCTACTTTGGA
CTCTGGGGTTTCAACAGCTCTCTGGCCTGCATTGCAATGGGAGGAATGTTCATGGCGCTC
ACCTGGCAAACCCACCTCCTGGCTCTTGGCTGTGCCCTGTTCACGGCCTATCTTGGAGTC
GGCATGGCAAACTTTATGGCTGAGGTTGGATTGCCAGCTTGTACCTGGCCCTTCTGTTTG
GCCACGCTATTGTTCCTCATCATGACCACAAAAAATTCCAACATCTACAAGATGCCCCTC
AGTAAAGTTACTTATCCTGAAGAAAACCGCATCTTCTACCTGCAAGCCAAGAAAAGAATG
GTGGAAAGCCCTTTGTGA
Chromosome Location
18
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ13336
UniProtKB Entry NameUT1_HUMAN
HGNC IDHGNC:10918
General References
  1. Olives B, Neau P, Bailly P, Hediger MA, Rousselet G, Cartron JP, Ripoche P: Cloning and functional expression of a urea transporter from human bone marrow cells. J Biol Chem. 1994 Dec 16;269(50):31649-52. [Article]
  2. Davey S, Beach D: RACH2, a novel human gene that complements a fission yeast cell cycle checkpoint mutation. Mol Biol Cell. 1995 Oct;6(10):1411-21. [Article]
  3. Olives B, Merriman M, Bailly P, Bain S, Barnett A, Todd J, Cartron JP, Merriman T: The molecular basis of the Kidd blood group polymorphism and its lack of association with type 1 diabetes susceptibility. Hum Mol Genet. 1997 Jul;6(7):1017-20. [Article]
  4. Sidoux-Walter F, Lucien N, Olives B, Gobin R, Rousselet G, Kamsteeg EJ, Ripoche P, Deen PM, Cartron JP, Bailly P: At physiological expression levels the Kidd blood group/urea transporter protein is not a water channel. J Biol Chem. 1999 Oct 15;274(42):30228-35. [Article]
  5. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [Article]
  6. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
  7. Wester ES, Johnson ST, Copeland T, Malde R, Lee E, Storry JR, Olsson ML: Erythroid urea transporter deficiency due to novel JKnull alleles. Transfusion. 2008 Feb;48(2):365-72. Epub 2007 Nov 19. [Article]
  8. Rungaldier S, Oberwagner W, Salzer U, Csaszar E, Prohaska R: Stomatin interacts with GLUT1/SLC2A1, band 3/SLC4A1, and aquaporin-1 in human erythrocyte membrane domains. Biochim Biophys Acta. 2013 Mar;1828(3):956-66. doi: 10.1016/j.bbamem.2012.11.030. Epub 2012 Dec 3. [Article]
  9. Sidoux-Walter F, Lucien N, Nissinen R, Sistonen P, Henry S, Moulds J, Cartron JP, Bailly P: Molecular heterogeneity of the Jk(null) phenotype: expression analysis of the Jk(S291P) mutation found in Finns. Blood. 2000 Aug 15;96(4):1566-73. [Article]
  10. Irshaid NM, Henry SM, Olsson ML: Genomic characterization of the kidd blood group gene:different molecular basis of the Jk(a-b-) phenotype in Polynesians and Finns. Transfusion. 2000 Jan;40(1):69-74. [Article]
  11. Liu HM, Lin JS, Chen PS, Lyou JY, Chen YJ, Tzeng CH: Two novel Jk(null) alleles derived from 222C>A in Exon 5 and 896G>A in Exon 9 of the JK gene. Transfusion. 2009 Feb;49(2):259-64. doi: 10.1111/j.1537-2995.2008.01958.x. Epub 2008 Oct 28. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB03904Ureaapproved, investigationalunknownsubstrateDetails