Carcinoembryonic antigen
Details
- Name
- Carcinoembryonic antigen
- Synonyms
- Not Available
- Gene Name
- Not Available
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0011772|Carcinoembryonic antigen MESPSAPPHRWCIPWQRLLLTGEGRTTWERVGGGSWGLLGRTGL
- Number of residues
- 44
- Molecular Weight
- 4903.595
- Theoretical pI
- 10.31
- GO Classification
- Not Available
- General Function
- Not Available
- Specific Function
- Not Available
- Pfam Domain Function
- Not Available
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Gene sequence
>lcl|BSEQ0004863|135 bp ATGGAGTCTCCCTCGGCCCCTCCCCACAGATGGTGCATCCCCTGGCAGAGGCTCCTGCTC ACAGGTGAAGGGAGGACAACCTGGGAGAGGGTGGGAGGAGGGAGCTGGGGTCTCCTGGGT AGGACAGGGCTGTGA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID Q14081 UniProtKB Entry Name Q14081_HUMAN GenBank Gene ID Z21818 - General References
- Schrewe H, Thompson J, Bona M, Hefta LJ, Maruya A, Hassauer M, Shively JE, von Kleist S, Zimmermann W: Cloning of the complete gene for carcinoembryonic antigen: analysis of its promoter indicates a region conveying cell type-specific expression. Mol Cell Biol. 1990 Jun;10(6):2738-48. [Article]
- Richards CA, Wolberg AS, Huber BE: The transcriptional control region of the human carcinoembryonic antigen gene: DNA sequence and homology studies. DNA Seq. 1993;4(3):185-96. [Article]
- Richards CA, Austin EA, Huber BE: Transcriptional regulatory sequences of carcinoembryonic antigen: identification and use with cytosine deaminase for tumor-specific gene therapy. Hum Gene Ther. 1995 Jul;6(7):881-93. [Article]