Chloramphenicol 3-O phosphotransferase

Details

Name
Chloramphenicol 3-O phosphotransferase
Synonyms
  • 2.7.1.-
  • CPT
Gene Name
Not Available
Organism
Streptomyces venezuelae (strain ATCC 10712 / CBS 650.69 / DSM 40230 / JCM 4526 / NBRC 13096 / PD 04745)
Amino acid sequence
>lcl|BSEQ0021976|Chloramphenicol 3-O phosphotransferase
MTTRMIILNGGSSAGKSGIVRCLQSVLPEPWLAFGVDSLIEAMPLKMQSAEGGIEFDADG
GVSIGPEFRALEGAWAEGVVAMARAGARIIIDDVFLGGAAAQERWRSFVGDLDVLWVGVR
CDGAVAEGRETARGDRVAGMAAKQAYVVHEGVEYDVEVDTTHKESIECAWAIAAHVVP
Number of residues
178
Molecular Weight
18816.255
Theoretical pI
4.38
GO Classification
Functions
ATP binding / kinase activity
Processes
response to antibiotic
General Function
Kinase activity
Specific Function
Inactivates chloramphenicol by catalyzing the transfer of the gamma-phosphate of ATP to the antibiotic's C-3' hydroxyl group.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0002963|537 bp
GTGACCACTCGGATGATCATCCTCAACGGCGGTTCCAGCGCGGGGAAGTCCGGCATCGTA
CGGTGCCTCCAGTCCGTCCTTCCCGAGCCCTGGCTGGCCTTCGGCGTCGACTCCCTCATC
GAGGCGATGCCCCTGAAGATGCAGAGCGCCGAAGGCGGCATCGAGTTCGACGCCGACGGC
GGGGTGAGCATCGGGCCCGAGTTCCGCGCCCTTGAGGGCGCCTGGGCCGAGGGCGTCGTC
GCGATGGCCCGCGCGGGCGCCCGGATCATCATCGACGACGTCTTCCTCGGCGGTGCCGCC
GCCCAGGAGCGCTGGCGGAGCTTCGTCGGGGACCTGGACGTGCTCTGGGTCGGCGTCCGG
TGCGACGGCGCCGTCGCCGAGGGCCGGGAGACCGCGCGCGGCGACCGCGTCGCGGGCATG
GCGGCGAAGCAGGCGTACGTCGTGCACGAGGGCGTGGAGTACGACGTGGAGGTCGACACC
ACGCACAAGGAGTCGATCGAGTGCGCCTGGGCGATCGCCGCCCACGTCGTCCCGTAG
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ56148
UniProtKB Entry NameCPT_STRVP
GenBank Protein ID498888
GenBank Gene IDU09991
General References
  1. Mosher RH, Camp DJ, Yang K, Brown MP, Shaw WV, Vining LC: Inactivation of chloramphenicol by O-phosphorylation. A novel resistance mechanism in Streptomyces venezuelae ISP5230, a chloramphenicol producer. J Biol Chem. 1995 Nov 10;270(45):27000-6. [Article]
  2. Pullan ST, Chandra G, Bibb MJ, Merrick M: Genome-wide analysis of the role of GlnR in Streptomyces venezuelae provides new insights into global nitrogen regulation in actinomycetes. BMC Genomics. 2011 Apr 4;12:175. doi: 10.1186/1471-2164-12-175. [Article]
  3. Izard T, Ellis J: The crystal structures of chloramphenicol phosphotransferase reveal a novel inactivation mechanism. EMBO J. 2000 Jun 1;19(11):2690-700. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB02608N-[(1R,2R)-1,3-Dihydroxy-1-(4-nitrophenyl)-2-propanyl]acetamideexperimentalunknownDetails
DB02930Adenosine 5'-[gamma-thio]triphosphateexperimentalunknownDetails
DB04411Alpha-N-Dichloroacetyl-P-AminophenylserinolexperimentalunknownDetails
DB00446Chloramphenicolapproved, vet_approvedunknownsubstrateDetails