Cholera enterotoxin B subunit
Details
- Name
- Cholera enterotoxin B subunit
- Synonyms
- Cholera enterotoxin subunit B
- Cholera toxin B protein (CTB)
- Cholera toxin B subunit
- Cholera toxin beta subunit
- Cholera toxin subunit B
- Cholerae toxin B subunit
- CtxB
- Gene Name
- ctxB
- Organism
- Vibrio cholerae
- Amino acid sequence
>lcl|BSEQ0019531|Cholera enterotoxin B subunit MIKLKFGVFFTVLLSSAYAHGTPQNITDLCAEYHNTQIHTLNDKIFSYTESLAGKREMAI ITFKNGATFQVEVPGSQHIDSQKKAIERMKDTLRIAYLTEAKVEKLCVWNNKTPHAIAAI SMAN
- Number of residues
- 124
- Molecular Weight
- 13918.975
- Theoretical pI
- 9.13
- GO Classification
- ProcessespathogenesisComponentsextracellular region
- General Function
- Not Available
- Specific Function
- Not Available
- Pfam Domain Function
- Enterotoxin_b (PF01376)
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID Q57193 UniProtKB Entry Name Q57193_VIBCL GenBank Protein ID 847822 GenBank Gene ID U25679 - General References
- Fan E, Merritt EA, Zhang Z, Pickens JC, Roach C, Ahn M, Hol WG: Exploration of the GM1 receptor-binding site of heat-labile enterotoxin and cholera toxin by phenyl-ring-containing galactose derivatives. Acta Crystallogr D Biol Crystallogr. 2001 Feb;57(Pt 2):201-12. [Article]
- Merritt EA, Zhang Z, Pickens JC, Ahn M, Hol WG, Fan E: Characterization and crystal structure of a high-affinity pentavalent receptor-binding inhibitor for cholera toxin and E. coli heat-labile enterotoxin. J Am Chem Soc. 2002 Jul 31;124(30):8818-24. [Article]
- Mitchell DD, Pickens JC, Korotkov K, Fan E, Hol WG: 3,5-Substituted phenyl galactosides as leads in designing effective cholera toxin antagonists; synthesis and crystallographic studies. Bioorg Med Chem. 2004 Mar 1;12(5):907-20. [Article]
- Okada K, Natakuathung W, Na-Ubol M, Roobthaisong A, Wongboot W, Maruyama F, Nakagawa I, Chantaroj S, Hamada S: Characterization of 3 Megabase-Sized Circular Replicons from Vibrio cholerae. Emerg Infect Dis. 2015 Jul;21(7):1262-3. doi: 10.3201/eid2107.141055. [Article]