3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
Details
- Name
- 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ
- Synonyms
- (3R)-hydroxymyristoyl-[acyl-carrier-protein] dehydratase
- 4.2.1.59
- Beta-hydroxyacyl-ACP dehydratase
- Gene Name
- fabZ
- UniProtKB Entry
- Q5G940TrEMBL
- Organism
- Helicobacter pylori
- NCBI Taxonomy ID
- 210
- Amino acid sequence
>lcl|BSEQ0022083|3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ MEQSHQNLQSQFFIEHILQILPHRYPMLLVDRITELQANQKIVAYKNITFNEDVFNGHFP NKPIFPGVLIVEGMAQSGGFLAFTSLWGFDPEIAKTKIVYFMTIDKVKFRIPVTPGDRLE YHLEVLKHKGMIWQVGGTAQVDGKVVAEAELKAMIAERE
- Number of residues
- 159
- Molecular Weight
- 18184.08
- Theoretical pI
- 6.81
- GO Classification
- Functions3-hydroxyoctanoyl-[acyl-carrier-protein] dehydratase activityProcessesfatty acid biosynthetic process / lipid A biosynthetic processComponentscytoplasm
- General Function
- 3-hydroxyoctanoyl-[acyl-carrier-protein] dehydratase activity
- Specific Function
- Involved in unsaturated fatty acids biosynthesis. Catalyzes the dehydration of short chain beta-hydroxyacyl-ACPs and long chain saturated and unsaturated beta-hydroxyacyl-ACPs.Involved in unsaturated fatty acids biosynthesis. Catalyzes the dehydration of short chain beta-hydroxyacyl-ACPs and long chain saturated and unsaturated beta-hydroxyacyl-ACPs (By similarity).
- Pfam Domain Function
- FabA (PF07977)
- Signal Regions
- Not Available
- Transmembrane Regions
- Not Available
- Cellular Location
- Cytoplasm
- Gene sequence
- Not Available
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID Q5G940 UniProtKB Entry Name Q5G940_HELPX GenBank Protein ID 56684725 GenBank Gene ID AY725427 PDB ID(s) 3B7J, 3CF8, 3CF9, 3D04, 3DOY, 3DOZ, 3DP0, 3DP1, 3DP2, 3DP3, 3ED0 - General References
- Liu W, Luo C, Han C, Peng S, Yang Y, Yue J, Shen X, Jiang H: A new beta-hydroxyacyl-acyl carrier protein dehydratase (FabZ) from Helicobacter pylori: Molecular cloning, enzymatic characterization, and structural modeling. Biochem Biophys Res Commun. 2005 Aug 12;333(4):1078-86. [Article]
- Kong YH, Zhang L, Yang ZY, Han C, Hu LH, Jiang HL, Shen X: Natural product juglone targets three key enzymes from Helicobacter pylori: inhibition assay with crystal structure characterization. Acta Pharmacol Sin. 2008 Jul;29(7):870-6. doi: 10.1111/j.1745-7254.2008.00808.x. [Article]
- Zhang L, Kong Y, Wu D, Zhang H, Wu J, Chen J, Ding J, Hu L, Jiang H, Shen X: Three flavonoids targeting the beta-hydroxyacyl-acyl carrier protein dehydratase from Helicobacter pylori: crystal structure characterization with enzymatic inhibition assay. Protein Sci. 2008 Nov;17(11):1971-8. doi: 10.1110/ps.036186.108. Epub 2008 Sep 9. [Article]
- Chen J, Zhang L, Zhang Y, Zhang H, Du J, Ding J, Guo Y, Jiang H, Shen X: Emodin targets the beta-hydroxyacyl-acyl carrier protein dehydratase from Helicobacter pylori: enzymatic inhibition assay with crystal structural and thermodynamic characterization. BMC Microbiol. 2009 May 12;9:91. doi: 10.1186/1471-2180-9-91. [Article]
- He L, Zhang L, Liu X, Li X, Zheng M, Li H, Yu K, Chen K, Shen X, Jiang H, Liu H: Discovering potent inhibitors against the beta-hydroxyacyl-acyl carrier protein dehydratase (FabZ) of Helicobacter pylori: structure-based design, synthesis, bioassay, and crystal structure determination. J Med Chem. 2009 Apr 23;52(8):2465-81. doi: 10.1021/jm8015602. [Article]
Associated Data
- Bio-Entities
Bio-Entity Type 3-hydroxyacyl-[acyl-carrier-protein] dehydratase FabZ (Helicobacter pylori) protein primary- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details N'-[(1E)-(3,5-dibromo-2,4-dihydroxyphenyl)methylidene]naphthalene-2-carbohydrazide experimental unknown target Details 4-chloro-N'-[(1E)-(3,5-dibromo-2,4-dihydroxyphenyl)methylidene]benzohydrazide experimental unknown target Details N'-[(1E)-(3,5-dibromo-2,4-dihydroxyphenyl)methylidene]-4-methoxybenzohydrazide experimental unknown target Details 3-bromo-N'-[(1E)-(3,5-dibromo-2,4-dihydroxyphenyl)methylidene]benzohydrazide experimental unknown target Details 4-tert-butyl-N'-[(1E)-(3,5-dibromo-2,4-dihydroxyphenyl)methylidene]benzohydrazide experimental unknown target Details 4-bromo-N'-[(1E)-(3,5-dibromo-2,4-dihydroxyphenyl)methylidene]benzohydrazide experimental unknown target Details Apigenin experimental unknown target Details Emodin investigational unknown target Details Quercetin experimental, investigational unknown target Details Sakuranetin experimental unknown target Details