30S ribosomal protein S18

Details

Name
30S ribosomal protein S18
Synonyms
Not Available
Gene Name
rpsR
Organism
Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)
Amino acid sequence
>lcl|BSEQ0012927|30S ribosomal protein S18
MSTKNAKPKKEAQRRPSRKAKVKATLGEFDLRDYRNVEVLKRFLSETGKILPRRRTGLSA
KEQRILAKTIKRARILGLLPFTEKLVRK
Number of residues
88
Molecular Weight
10231.105
Theoretical pI
12.1
GO Classification
Functions
rRNA binding / structural constituent of ribosome
Processes
translation
Components
ribosome
General Function
Structural constituent of ribosome
Specific Function
Located on the back of the platform of the 30S subunit where it stabilizes the close packing of several RNA helices of the 16S rRNA. Forms part of the Shine-Dalgarno cleft in the 70S ribosome, where it probably interacts with the Shine-Dalgarno helix.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0012928|30S ribosomal protein S18 (rpsR)
TTGAGCACGAAGAACGCGAAACCCAAGAAGGAGGCGCAGAGGCGCCCGTCCCGCAAGGCT
AAGGTCAAGGCCACCCTGGGGGAGTTTGACCTCAGGGACTACCGGAACGTGGAGGTGCTC
AAGCGGTTCCTGTCGGAGACGGGGAAGATCCTTCCCCGCCGCCGCACGGGGCTTTCCGCC
AAGGAGCAGAGGATCCTGGCCAAGACCATCAAGCGGGCGAGGATCCTAGGGCTCCTGCCC
TTCACGGAGAAGCTGGTGCGGAAGTAG
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ5SLQ0
UniProtKB Entry NameRS18_THET8
GenBank Protein ID55771383
GenBank Gene IDAP008226
General References
  1. Tsiboli P, Herfurth E, Choli T: Purification and characterization of the 30S ribosomal proteins from the bacterium Thermus thermophilus. Eur J Biochem. 1994 Nov 15;226(1):169-77. [Article]
  2. Suh MJ, Hamburg DM, Gregory ST, Dahlberg AE, Limbach PA: Extending ribosomal protein identifications to unsequenced bacterial strains using matrix-assisted laser desorption/ionization mass spectrometry. Proteomics. 2005 Dec;5(18):4818-31. [Article]
  3. Wimberly BT, Brodersen DE, Clemons WM Jr, Morgan-Warren RJ, Carter AP, Vonrhein C, Hartsch T, Ramakrishnan V: Structure of the 30S ribosomal subunit. Nature. 2000 Sep 21;407(6802):327-39. [Article]
  4. Schluenzen F, Tocilj A, Zarivach R, Harms J, Gluehmann M, Janell D, Bashan A, Bartels H, Agmon I, Franceschi F, Yonath A: Structure of functionally activated small ribosomal subunit at 3.3 angstroms resolution. Cell. 2000 Sep 1;102(5):615-23. [Article]
  5. Brodersen DE, Clemons WM Jr, Carter AP, Morgan-Warren RJ, Wimberly BT, Ramakrishnan V: The structural basis for the action of the antibiotics tetracycline, pactamycin, and hygromycin B on the 30S ribosomal subunit. Cell. 2000 Dec 22;103(7):1143-54. [Article]
  6. Carter AP, Clemons WM, Brodersen DE, Morgan-Warren RJ, Wimberly BT, Ramakrishnan V: Functional insights from the structure of the 30S ribosomal subunit and its interactions with antibiotics. Nature. 2000 Sep 21;407(6802):340-8. [Article]
  7. Agalarov SC, Sridhar Prasad G, Funke PM, Stout CD, Williamson JR: Structure of the S15,S6,S18-rRNA complex: assembly of the 30S ribosome central domain. Science. 2000 Apr 7;288(5463):107-13. [Article]
  8. Yusupova GZ, Yusupov MM, Cate JH, Noller HF: The path of messenger RNA through the ribosome. Cell. 2001 Jul 27;106(2):233-41. [Article]
  9. Pioletti M, Schlunzen F, Harms J, Zarivach R, Gluhmann M, Avila H, Bashan A, Bartels H, Auerbach T, Jacobi C, Hartsch T, Yonath A, Franceschi F: Crystal structures of complexes of the small ribosomal subunit with tetracycline, edeine and IF3. EMBO J. 2001 Apr 17;20(8):1829-39. [Article]
  10. Carter AP, Clemons WM Jr, Brodersen DE, Morgan-Warren RJ, Hartsch T, Wimberly BT, Ramakrishnan V: Crystal structure of an initiation factor bound to the 30S ribosomal subunit. Science. 2001 Jan 19;291(5503):498-501. [Article]
  11. Yusupov MM, Yusupova GZ, Baucom A, Lieberman K, Earnest TN, Cate JH, Noller HF: Crystal structure of the ribosome at 5.5 A resolution. Science. 2001 May 4;292(5518):883-96. Epub 2001 Mar 29. [Article]
  12. Ogle JM, Brodersen DE, Clemons WM Jr, Tarry MJ, Carter AP, Ramakrishnan V: Recognition of cognate transfer RNA by the 30S ribosomal subunit. Science. 2001 May 4;292(5518):897-902. [Article]
  13. Brodersen DE, Clemons WM Jr, Carter AP, Wimberly BT, Ramakrishnan V: Crystal structure of the 30 S ribosomal subunit from Thermus thermophilus: structure of the proteins and their interactions with 16 S RNA. J Mol Biol. 2002 Feb 22;316(3):725-68. [Article]
  14. Sharma MR, Barat C, Wilson DN, Booth TM, Kawazoe M, Hori-Takemoto C, Shirouzu M, Yokoyama S, Fucini P, Agrawal RK: Interaction of Era with the 30S ribosomal subunit implications for 30S subunit assembly. Mol Cell. 2005 Apr 29;18(3):319-29. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB081852-METHYLTHIO-N6-ISOPENTENYL-ADENOSINE-5'-MONOPHOSPHATEexperimentalunknownDetails