NADH dehydrogenase

Details

Name
NADH dehydrogenase
Synonyms
  • 1.6.99.3
  • H(2)O(2)-forming NADH oxidase
  • NADH:oxygen oxidoreductase
Gene Name
nox
Organism
Thermus thermophilus (strain HB8 / ATCC 27634 / DSM 579)
Amino acid sequence
>lcl|BSEQ0012129|NADH dehydrogenase
MEATLPVLDAKTAALKRRSIRRYRKDPVPEGLLREILEAALRAPSAWNLQPWRIVVVRDP
ATKRALREAAFGQAHVEEAPVVLVLYADLEDALAHLDEVIHPGVQGERREAQKQAIQRAF
AAMGQEARKAWASGQSYILLGYLLLLLEAYGLGSVPMLGFDPERVRAILGLPSHAAIPAL
VALGYPAEEGYPSHRLPLERVVLWR
Number of residues
205
Molecular Weight
22730.15
Theoretical pI
9.31
GO Classification
Functions
NADH dehydrogenase activity
General Function
Nadh dehydrogenase activity
Specific Function
Can oxidize either NADH or NADPH with a preference for NADH. Can catalyze electron transfer from NADH to various electron acceptors which include, in addition to molecular oxygen, cytochrome c, 2,6 dichlorphenolindophenol, methylene blue, ferricyanide or P-nitroblue tetrazolium.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0012130|NADH dehydrogenase (nox)
ATGGAGGCGACCCTTCCCGTTTTGGACGCGAAGACGGCGGCCCTAAAGAGGCGTTCCATC
CGGCGTTACCGGAAGGACCCCGTACCCGAGGGGCTTCTCCGGGAAATCCTCGAGGCCGCC
CTCCGGGCGCCCTCGGCCTGGAACCTCCAGCCCTGGCGGATCGTGGTGGTGCGGGACCCC
GCCACCAAACGGGCCCTGAGGGAGGCGGCCTTCGGCCAGGCCCACGTGGAGGAGGCCCCC
GTGGTCCTGGTCCTCTACGCCGACCTCGAGGACGCTCTCGCCCACCTGGACGAGGTCATC
CACCCCGGGGTCCAGGGGGAAAGGCGTGAGGCGCAGAAGCAGGCCATCCAACGGGCCTTC
GCCGCCATGGGGCAAGAGGCGCGAAAGGCCTGGGCCTCCGGGCAGAGCTACATCCTCTTG
GGCTACCTCCTTCTCCTCCTGGAGGCTTATGGCCTCGGAAGCGTCCCCATGCTGGGGTTT
GACCCCGAGAGGGTGAGGGCGATCCTGGGGCTTCCTTCCCACGCCGCCATCCCCGCCCTG
GTGGCCTTGGGCTACCCGGCGGAGGAGGGCTACCCCTCCCACCGCCTGCCCCTGGAGCGG
GTGGTCCTCTGGCGCTAG
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ60049
UniProtKB Entry NameNOX_THET8
GenBank Gene IDX60110
General References
  1. Park HJ, Kreutzer R, Reiser CO, Sprinzl M: Molecular cloning and nucleotide sequence of the gene encoding a H2O2-forming NADH oxidase from the extreme thermophilic Thermus thermophilus HB8 and its expression in Escherichia coli. Eur J Biochem. 1992 May 1;205(3):875-9. [PubMed:1577004]
  2. Park HJ, Kreutzer R, Reiser CO, Sprinzl M: Molecular cloning and nucleotide sequence of the gene encoding a H2O2-forming NADH oxidase from the extreme thermophilic Thermus thermophilus HB8 and its expression in Escherichia coli. Eur J Biochem. 1993 Feb 1;211(3):909. [PubMed:8436145]
  3. Park HJ, Reiser CO, Kondruweit S, Erdmann H, Schmid RD, Sprinzl M: Purification and characterization of a NADH oxidase from the thermophile Thermus thermophilus HB8. Eur J Biochem. 1992 May 1;205(3):881-5. [PubMed:1577005]
  4. Hecht HJ, Erdmann H, Park HJ, Sprinzl M, Schmid RD: Crystal structure of NADH oxidase from Thermus thermophilus. Nat Struct Biol. 1995 Dec;2(12):1109-14. [PubMed:8846223]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB03247Flavin mononucleotideapproved, investigationalunknownDetails