Peptide deformylase
Details
- Name
- Peptide deformylase
- Synonyms
- 3.5.1.88
- Polypeptide deformylase
- Gene Name
- def
- Organism
- Helicobacter pylori
- Amino acid sequence
>lcl|BSEQ0022111|Peptide deformylase MALLEIIHYPSKILRTISKEVVSFDAKLHQQLDDMYETMIASEGIGLAAIQVGLPLRMLI INLPQEDGVQHKEDCLEIINPKFIETGGSMMYKEGCLSVPGFYEEVERFEKVKIEYQNRF AEVKVLEASELLAVAIQHEIDHLNGVLFVDKLSILKRKKFEKELKELQKKQKHK
- Number of residues
- 174
- Molecular Weight
- 20038.335
- Theoretical pI
- 6.25
- GO Classification
- Functionsiron ion binding / peptide deformylase activityProcessestranslation
- General Function
- Peptide deformylase activity
- Specific Function
- Removes the formyl group from the N-terminal Met of newly synthesized proteins. Requires at least a dipeptide for an efficient rate of reaction. N-terminal L-methionine is a prerequisite for activity but the enzyme has broad specificity at other positions.
- Pfam Domain Function
- Pep_deformylase (PF01327)
- Transmembrane Regions
- Not Available
- Cellular Location
- Cytoplasmic
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID Q672W7 UniProtKB Entry Name Q672W7_HELPX GenBank Protein ID 49089809 GenBank Gene ID AY559449 - General References
- Han C, Wang Q, Dong L, Sun H, Peng S, Chen J, Yang Y, Yue J, Shen X, Jiang H: Molecular cloning and characterization of a new peptide deformylase from human pathogenic bacterium Helicobacter pylori. Biochem Biophys Res Commun. 2004 Jul 9;319(4):1292-8. [Article]
- Cai J, Han C, Hu T, Zhang J, Wu D, Wang F, Liu Y, Ding J, Chen K, Yue J, Shen X, Jiang H: Peptide deformylase is a potential target for anti-Helicobacter pylori drugs: reverse docking, enzymatic assay, and X-ray crystallography validation. Protein Sci. 2006 Sep;15(9):2071-81. Epub 2006 Aug 1. [Article]