HBsAg

Details

Name
HBsAg
Synonyms
  • Major Surface Antigen
  • S
  • S protein
  • sAg
  • Small S protein
  • Small surface antigen
  • Surface antigen
Gene Name
S gene
Organism
HBV
Amino acid sequence
>lcl|BSEQ0011738|HBsAg
MENITSGFLGPLLVLQAGFFLLTRILTIPQSLDSWWTSLNFLGGTTVCLGQNSQSPTSNH
SPTSCPPTCPGYRWMCLRRFIIFLFILLLCLIFLLVLLDYQGMLPVCPLIPGSSTTSTGP
CRTCMTTAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGKFLWEWASARFSWLSLLVPFV
QWFVGLSPTVWLSVIWMMWYWGPSLYSILSPFLPLLPIFFCLWVYI
Number of residues
226
Molecular Weight
25420.905
Theoretical pI
7.9
GO Classification
Processes
membrane fusion involved in viral entry into host cell / virion attachment to host cell
Components
integral component of membrane / virion membrane
General Function
Not Available
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
80-98 170-199 205-225
Cellular Location
Virion membrane
Gene sequence
>lcl|BSEQ0004765|681 bp
ATGGAGAACATCACATCAGGATTCCTAGGACCCCTTCTCGTGTTACAGGCGGGGTTTTTC
TTGTTGACAAGAATCCTCACAATACCGCAGAGTCTAGACTCGTGGTGGACTTCTCTCAAT
TTTCTAGGGGGAACTACCGTGTGTCTTGGCCAAAATTCGCAGTCCCCAACCTCCAATCAC
TCACCAACCTCCTGTCCTCCAACTTGTCCTGGTTATCGCTGGATGTGTCTGCGGCGTTTT
ATCATCTTCCTCTTCATCCTGCTGCTATGCCTCATCTTCTTGTTGGTTCTTCTGGACTAT
CAAGGTATGTTGCCCGTTTGTCCTCTAATTCCAGGATCCTCAACCACCAGCACGGGACCA
TGCCGAACCTGCATGACAACTGCTCAAGGAACCTCTATGTATCCCTCCTGTTGCTGTACC
AAACCTTCGGACGGAAATTGCACCTGTATTCCCATCCCATCATCCTGGGCTTTCGGAAAA
TTCCTATGGGAGTGGGCCTCAGCCCGTTTCTCCTGGCTCAGTTTACTAGTGCCATTTGTT
CAGTGGTTCGTAGGGCTTTCCCCCACTGTTTGGCTTTCAGTTATATGGATGATGTGGTAT
TGGGGGCCAAGTCTGTACAGCATCTTGAGTCCCTTTTTACCGCTGTTACCAATTTTCTTT
TGTCTTTGGGTATACATTTAA
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ69600
UniProtKB Entry NameQ69600_HBV
GenBank Gene IDX75668
General References
  1. Norder H, Hammas B, Lofdahl S, Courouce AM, Magnius LO: Comparison of the amino acid sequences of nine different serotypes of hepatitis B surface antigen and genomic classification of the corresponding hepatitis B virus strains. J Gen Virol. 1992 May;73 ( Pt 5):1201-8. [Article]
  2. Arauz-Ruiz P, Norder H, Visona KA, Magnius LO: Molecular epidemiology of hepatitis B virus in Central America reflected in the genetic variability of the small S gene. J Infect Dis. 1997 Oct;176(4):851-8. [Article]
  3. Christensen PB, Krarup HB, Niesters HG, Norder H, Schaffalitzky de Muckadell OB, Jeune B, Georgsen J: Outbreak of Hepatitis B among injecting drug users in Denmark. J Clin Virol. 2001 Aug;22(1):133-41. [Article]
  4. Norder H, Courouce AM, Coursaget P, Echevarria JM, Lee SD, Mushahwar IK, Robertson BH, Locarnini S, Magnius LO: Genetic diversity of hepatitis B virus strains derived worldwide: genotypes, subgenotypes, and HBsAg subtypes. Intervirology. 2004;47(6):289-309. [Article]
  5. Zehender G, De Maddalena C, Giambelli C, Milazzo L, Schiavini M, Bruno R, Tanzi E, Galli M: Different evolutionary rates and epidemic growth of hepatitis B virus genotypes A and D. Virology. 2008 Oct 10;380(1):84-90. doi: 10.1016/j.virol.2008.07.009. Epub 2008 Aug 19. [Article]
  6. Ghosh S, Banerjee P, RoyChoudhury A, Sarkar S, Ghosh A, Santra A, Banerjee S, Das K, Dwibedi B, Kar SK, Rao VG, Bhat JT, Singh N, Chowdhury A, Datta S: Unique hepatitis B virus subgenotype in a primitive tribal community in eastern India. J Clin Microbiol. 2010 Nov;48(11):4063-71. doi: 10.1128/JCM.01174-10. Epub 2010 Sep 15. [Article]
  7. Pourkarim MR, Amini-Bavil-Olyaee S, Verbeeck J, Lemey P, Zeller M, Rahman M, Maes P, Nevens F, Van Ranst M: Molecular evolutionary analysis and mutational pattern of full-length genomes of hepatitis B virus isolated from Belgian patients with different clinical manifestations. J Med Virol. 2010 Mar;82(3):379-89. doi: 10.1002/jmv.21726. [Article]
  8. Habbal W, Monem F: Rethinking therapeutic decisions for hepatitis B infection in Syria: insights into molecular monitoring. J Infect Dev Ctries. 2012 Oct 19;6(10):744-7. doi: 10.3855/jidc.2596. [Article]
  9. Delwart E, Slikas E, Stramer SL, Kamel H, Kessler D, Krysztof D, Tobler LH, Carrick DM, Steele W, Todd D, Wright DJ, Kleinman SH, Busch MP: Genetic diversity of recently acquired and prevalent HIV, hepatitis B virus, and hepatitis C virus infections in US blood donors. J Infect Dis. 2012 Mar 15;205(6):875-85. doi: 10.1093/infdis/jir862. Epub 2012 Jan 31. [Article]
  10. Habbal W, Gartner BC, Monem F: Identification of optimal target gene regions for hepatitis B virus genotyping by DNA sequencing. Intervirology. 2013;56(5):325-36. doi: 10.1159/000353108. Epub 2013 Aug 20. [Article]
  11. Loureiro CL, Aguilar JC, Aguiar J, Muzio V, Penton E, Garcia D, Guillen G, Pujol FH: HBV genotypic variability in Cuba. PLoS One. 2015 Mar 5;10(3):e0118959. doi: 10.1371/journal.pone.0118959. eCollection 2015. [Article]
  12. Jeantet D, Chemin I, Mandrand B, Zoulim F, Trepo C, Kay A: Characterization of two hepatitis B virus populations isolated from a hepatitis B surface antigen-negative patient. Hepatology. 2002 May;35(5):1215-24. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB05276Hepatitis B immune globulinapproved, investigationalunknownDetails