Hephaestin-like protein 1

Details

Name
Hephaestin-like protein 1
Synonyms
  • 1.-.-.-
Gene Name
HEPHL1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0019817|Hephaestin-like protein 1
MPRKQPAGCIFLLTFLGLSGLVGTVTRTYYIGIVEEYWNYVPQGKNVITGKSFTEDKLAT
LFLERGPNRIGSIYKKAVYRRFTDGTYSIEIPKPPWLGFLGPILRAEVGDVIVIHLKNFA
SRPYSLHPHGVFYNKDSEGALYPDGTSGRNKNDDMVPPGKNYTYVWPVREEYAPTPADAN
CLTWVYHSHIDAPKDICSGLIGPLLVCKEGILNRYSGTRNDVDREFVIMFTLVDENQSWY
LNENIKHFCTNPDSVDKKDAVFQRSNKMHALNGYLFGNFPEPDMCVGESVSWHLFGMGNE
IDIHSIYFYGNTFISRGHRTDVVNLFPATFLTTEMIAENPGKWMITCQVSDHLQAGMLGQ
YNVDNCKSDIFYPKMKGQQRRYFIAAEKILWDYAPQGYNKFSGLPLNASGSDSDLYFTQG
DNRIGGKYWKVRYTEFVDATFTKRKRLSAEEAHLGILGPVIKAEVGDTLLVTFANKADKV
YSILPHGVIYDKASDAAPNLDGFVKPGAHVKPGETFTYKWTVPESVSPTAGDPPCLTYLY
FSAVDPIKDTSSGLVGPLLVCKKGVLNADGTQKGIDKEFYLLFTVFDENLSRYFDENIQK
FIWHPFSIDKEDKEFVKSNRMHAVNGYMYGNQPGLNMCKRDRVSWHLIGLGTDTDMHGIV
FQGNTIHLRGTHRDSLALFPHMATTAFMQPDHAGIFRVFCATMPHLSRGMGQIYEVSSCD
NRDPSEQRYGMIRTFYIAAEEVEWDYAPNKNWEFEKQHVDARGERHGDIFMNRTENWIGS
QYKKVVYREYTDGEFVEIKARPPREEHLELLGPMIHAEVGNTVLIIFKNKASRPYSISAQ
GVEEMDSGKQFQVPMTKPGEVKTYRWNIPKRSGPGPSDPNCIPWVYYSTVNFVKDTYSGL
MGPLITCRKGVLNEKGRRSDVDYEFALLFLVFNENESWYLDDNIKKYLNKDPRDFKRTDD
FEESNRMHAINGKIFGNLHGLIMNEDTMTNWYLLGIGSEVDIHTIHYHAESFLFKIDKSY
REDVYDLFPGTFQTIELFADHPGTWLLHCHVSDHIHAGMETTYTVLRNIDNRIPYSTTSP
GVASHPATVPSNERPGKEQLYFFGKNLGPTGAKAALVILFIIGLLLLITTVILSLRLCSA
MKQTDYQQVQSCALPTDAL
Number of residues
1159
Molecular Weight
131601.67
Theoretical pI
Not Available
GO Classification
Functions
copper ion binding / ferroxidase activity
Processes
copper ion transport / oxidation-reduction process
Components
integral component of membrane
General Function
Ferroxidase activity
Specific Function
May function as a ferroxidase and may be involved in copper transport and homeostasis.
Pfam Domain Function
Transmembrane Regions
1115-1135
Cellular Location
Membrane
Gene sequence
>lcl|BSEQ0019818|Hephaestin-like protein 1 (HEPHL1)
ATGCCTCGGAAGCAGCCAGCTGGCTGCATCTTTCTCCTCACATTCCTGGGTCTGTCTGGG
CTGGTTGGCACAGTTACCAGAACGTACTACATTGGGATTGTGGAAGAATACTGGAACTAT
GTACCCCAAGGGAAGAATGTTATTACTGGGAAAAGTTTCACAGAAGACAAACTTGCAACC
TTATTTCTCGAAAGAGGGCCCAACAGGATAGGCAGTATTTACAAAAAGGCTGTTTACAGA
CGCTTCACGGATGGAACCTACTCCATAGAGATCCCCAAACCTCCCTGGCTTGGATTCCTG
GGCCCCATCTTGAGGGCCGAAGTGGGTGATGTGATTGTCATTCATTTAAAGAACTTTGCT
TCTCGACCTTACTCTCTGCATCCACATGGCGTTTTCTACAACAAAGATTCAGAAGGAGCC
CTATACCCAGATGGAACATCTGGAAGGAACAAAAATGATGACATGGTTCCTCCTGGGAAA
AACTACACCTACGTCTGGCCGGTGAGAGAAGAATATGCACCTACTCCAGCCGATGCCAAC
TGCCTGACCTGGGTGTACCATTCGCACATCGACGCCCCAAAGGACATCTGCTCTGGGCTA
ATTGGGCCCCTGCTGGTCTGCAAGGAAGGTATCCTGAATAGATATTCAGGGACACGGAAT
GATGTGGATCGAGAGTTTGTTATAATGTTTACTCTTGTGGATGAGAATCAAAGCTGGTAC
CTCAATGAAAATATCAAACATTTCTGCACCAACCCTGATTCAGTTGACAAGAAAGATGCT
GTTTTCCAGAGGAGTAACAAAATGCATGCCCTCAATGGATACCTCTTCGGAAACTTCCCG
GAGCCTGATATGTGTGTTGGAGAATCTGTGTCCTGGCACCTATTTGGAATGGGGAATGAA
ATAGACATCCATTCTATCTATTTCTATGGTAACACCTTCATCAGCAGAGGGCATCGGACT
GATGTCGTCAACCTGTTCCCAGCCACCTTCCTTACAACAGAAATGATAGCCGAGAATCCT
GGGAAGTGGATGATAACCTGCCAGGTCAGCGACCACCTACAAGCTGGTATGCTGGGGCAA
TACAATGTTGATAACTGCAAAAGTGATATTTTCTACCCCAAGATGAAGGGTCAACAGAGG
CGCTACTTTATAGCAGCTGAAAAAATTCTTTGGGATTATGCTCCTCAAGGCTATAACAAA
TTCAGTGGTCTTCCTCTAAACGCCTCTGGCAGTGACTCTGATCTCTACTTCACACAAGGG
GACAACAGAATAGGAGGAAAATACTGGAAGGTTCGGTATACTGAATTTGTTGATGCAACT
TTTACTAAAAGAAAGAGACTCTCTGCTGAAGAAGCCCATCTTGGAATTCTTGGCCCAGTC
ATCAAGGCAGAGGTGGGTGATACCCTGTTAGTGACCTTTGCCAACAAAGCCGACAAGGTC
TATAGCATTTTACCCCATGGTGTGATCTATGACAAGGCATCTGATGCAGCCCCAAACCTA
GATGGATTTGTGAAACCAGGGGCGCATGTTAAACCAGGTGAAACCTTCACATACAAGTGG
ACAGTGCCTGAGAGCGTAAGCCCAACTGCTGGTGATCCTCCCTGTCTGACCTATCTTTAC
TTCTCAGCAGTTGATCCAATTAAGGACACCAGCTCTGGCCTGGTAGGGCCTTTGCTAGTC
TGTAAAAAGGGCGTCCTCAATGCTGATGGGACACAGAAAGGAATAGACAAGGAGTTTTAC
CTACTGTTCACAGTCTTTGATGAGAATCTGAGCAGATATTTTGATGAAAACATTCAGAAG
TTTATCTGGCATCCCTTCAGCATTGACAAAGAAGATAAAGAGTTTGTGAAATCCAACCGA
ATGCATGCTGTTAACGGCTACATGTATGGCAACCAGCCAGGCTTAAACATGTGTAAAAGG
GATAGAGTTTCCTGGCATCTGATTGGATTGGGCACTGACACTGACATGCATGGAATTGTT
TTTCAAGGGAACACCATCCACCTACGAGGGACTCACCGAGACTCCCTGGCCCTGTTTCCC
CACATGGCCACAACAGCATTCATGCAGCCAGACCATGCAGGTATTTTTAGGGTGTTTTGT
GCCACCATGCCCCACCTCTCGAGAGGCATGGGTCAGATCTATGAGGTCAGCAGCTGTGAC
AACAGGGACCCTTCTGAGCAGCGGTACGGGATGATAAGAACTTTTTACATCGCCGCTGAA
GAAGTAGAATGGGATTATGCCCCTAACAAAAACTGGGAGTTCGAAAAGCAGCACGTGGAC
GCAAGAGGGGAAAGACATGGAGATATATTTATGAACCGCACTGAAAATTGGATTGGCTCT
CAGTACAAGAAGGTGGTTTACAGGGAATATACGGATGGAGAATTTGTGGAGATCAAAGCC
CGACCACCACGAGAGGAGCACTTAGAACTCCTGGGCCCAATGATTCATGCTGAGGTGGGC
AACACCGTCCTGATCATATTTAAGAACAAAGCCAGTAGGCCCTACTCCATCTCAGCCCAG
GGTGTGGAGGAGATGGATAGTGGAAAGCAATTCCAAGTGCCCATGACAAAACCAGGAGAA
GTAAAAACTTATAGATGGAATATCCCTAAAAGATCCGGTCCAGGGCCTTCTGATCCCAAT
TGTATTCCATGGGTTTACTATTCAACAGTAAACTTTGTGAAGGATACGTATAGTGGTTTG
ATGGGTCCTCTGATTACATGCCGAAAAGGAGTCTTGAATGAAAAGGGAAGAAGAAGTGAC
GTTGATTATGAATTTGCTCTCTTGTTTTTGGTATTTAATGAGAATGAATCCTGGTATCTG
GATGACAATATTAAGAAGTATCTCAACAAAGATCCACGAGATTTTAAGCGCACTGATGAT
TTTGAGGAAAGCAACAGAATGCATGCCATTAATGGAAAGATTTTTGGGAATCTCCATGGC
CTCATAATGAACGAAGATACAATGACAAACTGGTATTTGTTAGGGATAGGAAGTGAAGTG
GACATACATACCATCCATTATCATGCTGAGAGCTTTCTTTTCAAAATAGATAAATCTTAC
CGAGAAGATGTGTATGATCTCTTTCCTGGGACATTCCAAACCATTGAACTGTTTGCAGAT
CACCCAGGGACATGGCTGCTACACTGTCATGTGTCTGACCACATCCATGCTGGCATGGAG
ACAACCTACACGGTCCTTCGTAACATAGACAACAGGATTCCTTACTCCACCACATCTCCT
GGAGTGGCATCTCACCCAGCCACGGTGCCATCTAACGAACGACCTGGCAAAGAGCAGCTC
TATTTCTTTGGCAAGAATCTGGGTCCAACAGGAGCCAAGGCAGCCTTGGTCATCCTTTTC
ATCATTGGACTCCTCCTTCTAATCACCACGGTGATTCTCTCCCTCAGACTCTGCTCTGCA
ATGAAGCAGACAGATTACCAGCAAGTCCAGTCCTGTGCTCTCCCCACGGATGCTCTGTGA
Chromosome Location
11
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ6MZM0
UniProtKB Entry NameHPHL1_HUMAN
HGNC IDHGNC:30477
General References
  1. Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES, Sakaki Y: Human chromosome 11 DNA sequence and analysis including novel gene identification. Nature. 2006 Mar 23;440(7083):497-500. [PubMed:16554811]
  2. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [PubMed:17974005]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB09130Copperapproved, investigationalunknowncofactorDetails