Pyridoxal-dependent decarboxylase domain-containing protein 1

Details

Name
Pyridoxal-dependent decarboxylase domain-containing protein 1
Synonyms
  • 4.1.1.-
  • KIAA0251
Gene Name
PDXDC1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0037169|Pyridoxal-dependent decarboxylase domain-containing protein 1
MDASLEKIADPTLAEMGKNLKEAVKMLEDSQRRTEEENGKKLISGDIPGPLQGSGQDMVS
ILQLVQNLMHGDEDEEPQSPRIQNIGEQGHMALLGHSLGAYISTLDKEKLRKLTTRILSD
TTLWLCRIFRYENGCAYFHEEEREGLAKICRLAIHSRYEDFVVDGFNVLYNKKPVIYLSA
AARPGLGQYLCNQLGLPFPCLCRVPCNTVFGSQHQMDVAFLEKLIKDDIERGRLPLLLVA
NAGTAAVGHTDKIGRLKELCEQYGIWLHVEGVNLATLALGYVSSSVLAAAKCDSMTMTPG
PWLGLPAVPAVTLYKHDDPALTLVAGLTSNKPTDKLRALPLWLSLQYLGLDGFVERIKHA
CQLSQRLQESLKKVNYIKILVEDELSSPVVVFRFFQELPGSDPVFKAVPVPNMTPSGVGR
ERHSCDALNRWLGEQLKQLVPASGLTVMDLEAEGTCLRFSPLMTAAVLGTRGEDVDQLVA
CIESKLPVLCCTLQLREEFKQEVEATAGLLYVDDPNWSGIGVVRYEHANDDKSSLKSDPE
GENIHAGLLKKLNELESDLTFKIGPEYKSMKSCLYVGMASDNVDAAELVETIAATAREIE
ENSRLLENMTEVVRKGIQEAQVELQKASEERLLEEGVLRQIPVVGSVLNWFSPVQALQKG
RTFNLTAGSLESTEPIYVYKAQGAGVTLPPTPSGSRTKQRLPGQKPFKRSLRGSDALSET
SSVSHIEDLEKVERLSSGPEQITLEASSTEGHPGAPSPQHTDQTEAFQKGVPHPEDDHSQ
VEGPESLR
Number of residues
788
Molecular Weight
86706.135
Theoretical pI
4.97
GO Classification
Functions
carboxy-lyase activity / pyridoxal phosphate binding
Processes
carboxylic acid metabolic process
Components
Golgi apparatus / intracellular membrane-bounded organelle
General Function
Pyridoxal phosphate binding
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0021322|Pyridoxal-dependent decarboxylase domain-containing protein 1 (PDXDC1)
ATGGACGCGTCCCTGGAGAAGATAGCAGACCCCACGTTAGCTGAAATGGGAAAAAACTTG
AAGGAGGCAGTGAAGATGCTGGAGGACAGTCAGAGAAGAACAGAAGAGGAAAATGGAAAG
AAGCTCATATCCGGAGATATTCCAGGCCCACTCCAGGGCAGAATCCAAAATATTGGAGAA
CAAGGTCATATGGCTTTGTTGGGACATAGTCTGGGAGCTTATATTTCAACTCTGGACAAA
GAGAAGCTGAGAAAACTTACAACTAGGATACTTTCAGATACCACCTTATGGCTATGCAGA
ATTTTCAGATATGAAAATGGGTGTGCTTATTTCCACGAAGAGGAAAGAGAAGGACTTGCA
AAGATATGTAGGCTTGCCATTCATTCTCGATATGAAGACTTCGTAGTGGATGGCTTCAAT
GTGTTATATAACAAGAAGCCTGTCATATATCTTAGTGCTGCTGCTAGACCTGGCCTGGGC
CAATACCTTTGTAATCAGCTCGGCTTGCCCTTCCCCTGCTTGTGCCGTGTACCCTGTAAC
ACTGTGTTTGGATCCCAGCATCAGATGGATGTTGCCTTCCTGGAGAAACTGATTAAAGAT
GATATAGAGCGAGGAAGACTGCCCCTGTTGCTTGTCGCAAATGCAGGAACGGCAGCAGTA
GGACACACAGACAAGATTGGGAGATTGAAAGAACTCTGTGAGCAGTATGGCATATGGCTT
CATGTGGAGGGTGTGAATCTGGCAACATTGGCTCTGGGTTATGTCTCCTCATCAGTGCTG
GCTGCAGCCAAATGTGATAGCATGACGATGACTCCTGGCCCGTGGCTGGGTTTGCCAGCT
GTTCCTGCGGTGACACTGTATAAACACGATGACCCTGCCTTGACTTTAGTTGCTGGTCTT
ACATCAAATAAGCCCACAGACAAACTCCGTGCCCTGCCTCTGTGGTTATCTTTACAATAC
TTGGGACTTGATGGGTTTGTGGAGAGGATCAAGCATGCCTGTCAACTGAGTCAACGGTTG
CAGGAAAGTTTGAAGAAAGTGAATTACATCAAAATCTTGGTGGAAGATGAGCTCAGCTCC
CCAGTGGTGGTGTTCAGATTTTTCCAGGAATTACCAGGCTCAGATCCGGTGTTTAAAGCC
GTCCCAGTGCCCAACATGACACCTTCAGGAGTCGGCCGGGAGAGGCACTCGTGTGACGCG
CTGAATCGCTGGCTGGGAGAACAGCTGAAGCAGCTGGTGCCTGCAAGCGGCCTCACAGTC
ATGGATCTGGAAGCTGAGGGCACGTGTTTGCGGTTCAGCCCTTTGATGACCGCAGCAGTT
TTAGGAACTCGGGGAGAGGATGTGGATCAGCTCGTAGCCTGCATAGAAAGCAAACTGCCA
GTGCTGTGCTGTACGCTCCAGTTGCGTGAAGAGTTCAAGCAGGAAGTGGAAGCAACAGCA
GGTCTCCTATATGTTGATGACCCTAACTGGTCTGGAATAGGGGTTGTCAGGTATGAACAT
GCTAATGATGATAAGAGCAGTTTGAAATCAGATCCCGAAGGGGAAAACATCCATGCTGGA
CTCCTGAAGAAGTTAAATGAACTGGAATCTGACCTAACCTTTAAAATAGGCCCTGAGTAT
AAGAGCATGAAGAGCTGCCTTTATGTCGGCATGGCGAGCGACAACGTCGATGCTGCTGAG
CTCGTGGAGACCATTGCGGCCACAGCCCGGGAGATAGAGGAGAACTCGAGGCTTCTGGAA
AACATGACAGAAGTGGTTCGGAAAGGCATTCAGGAAGCTCAAGTGGAGCTGCAGAAGGCA
AGTGAAGAACGGCTTCTGGAAGAGGGGGTGTTGCGGCAGATCCCTGTAGTGGGCTCCGTG
CTGAATTGGTTTTCTCCGGTCCAGGCTTTACAGAAGGGAAGAACTTTTAACTTGACAGCA
GGCTCTCTGGAGTCCACAGAACCCATATATGTCTACAAAGCACAAGGTGCAGGAGTCACG
CTGCCTCCAACGCCCTCGGGCAGTCGCACCAAGCAGAGGCTTCCAGGCCAGAAGCCTTTT
AAAAGGTCCCTGCGAGGTTCAGATGCTTTGAGTGAGACCAGCTCAGTCAGTCACATTGAA
GACTTAGAAAAGGTGGAGCGCCTATCCAGTGGGCCGGAGCAGATCACCCTCGAGGCCAGC
AGCACTGAGGGACACCCAGGGGCTCCCAGCCCTCAGCACACCGACCAGACCGAGGCCTTC
CAGAAAGGGGTCCCACACCCAGAAGATGACCACTCACAGGTAGAAGGACCGGAGAGCTTA
AGATGA
Chromosome Location
16
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ6P996
UniProtKB Entry NamePDXD1_HUMAN
GenBank Protein ID38174269
GenBank Gene IDBC060871
GenAtlas IDPDXDC1
HGNC IDHGNC:28995
General References
  1. Nagase T, Seki N, Ishikawa K, Ohira M, Kawarabayasi Y, Ohara O, Tanaka A, Kotani H, Miyajima N, Nomura N: Prediction of the coding sequences of unidentified human genes. VI. The coding sequences of 80 new genes (KIAA0201-KIAA0280) deduced by analysis of cDNA clones from cell line KG-1 and brain. DNA Res. 1996 Oct 31;3(5):321-9, 341-54. [PubMed:9039502]
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  3. Martin J, Han C, Gordon LA, Terry A, Prabhakar S, She X, Xie G, Hellsten U, Chan YM, Altherr M, Couronne O, Aerts A, Bajorek E, Black S, Blumer H, Branscomb E, Brown NC, Bruno WJ, Buckingham JM, Callen DF, Campbell CS, Campbell ML, Campbell EW, Caoile C, Challacombe JF, Chasteen LA, Chertkov O, Chi HC, Christensen M, Clark LM, Cohn JD, Denys M, Detter JC, Dickson M, Dimitrijevic-Bussod M, Escobar J, Fawcett JJ, Flowers D, Fotopulos D, Glavina T, Gomez M, Gonzales E, Goodstein D, Goodwin LA, Grady DL, Grigoriev I, Groza M, Hammon N, Hawkins T, Haydu L, Hildebrand CE, Huang W, Israni S, Jett J, Jewett PB, Kadner K, Kimball H, Kobayashi A, Krawczyk MC, Leyba T, Longmire JL, Lopez F, Lou Y, Lowry S, Ludeman T, Manohar CF, Mark GA, McMurray KL, Meincke LJ, Morgan J, Moyzis RK, Mundt MO, Munk AC, Nandkeshwar RD, Pitluck S, Pollard M, Predki P, Parson-Quintana B, Ramirez L, Rash S, Retterer J, Ricke DO, Robinson DL, Rodriguez A, Salamov A, Saunders EH, Scott D, Shough T, Stallings RL, Stalvey M, Sutherland RD, Tapia R, Tesmer JG, Thayer N, Thompson LS, Tice H, Torney DC, Tran-Gyamfi M, Tsai M, Ulanovsky LE, Ustaszewska A, Vo N, White PS, Williams AL, Wills PL, Wu JR, Wu K, Yang J, Dejong P, Bruce D, Doggett NA, Deaven L, Schmutz J, Grimwood J, Richardson P, Rokhsar DS, Eichler EE, Gilna P, Lucas SM, Myers RM, Rubin EM, Pennacchio LA: The sequence and analysis of duplication-rich human chromosome 16. Nature. 2004 Dec 23;432(7020):988-94. [PubMed:15616553]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  5. Olsen JV, Blagoev B, Gnad F, Macek B, Kumar C, Mortensen P, Mann M: Global, in vivo, and site-specific phosphorylation dynamics in signaling networks. Cell. 2006 Nov 3;127(3):635-48. [PubMed:17081983]
  6. Beausoleil SA, Villen J, Gerber SA, Rush J, Gygi SP: A probability-based approach for high-throughput protein phosphorylation analysis and site localization. Nat Biotechnol. 2006 Oct;24(10):1285-92. Epub 2006 Sep 10. [PubMed:16964243]
  7. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [PubMed:18669648]
  8. Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M: Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Sci Signal. 2010 Jan 12;3(104):ra3. doi: 10.1126/scisignal.2000475. [PubMed:20068231]
  9. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [PubMed:21269460]
  10. Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B: System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation. Sci Signal. 2011 Mar 15;4(164):rs3. doi: 10.1126/scisignal.2001570. [PubMed:21406692]
  11. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [PubMed:24275569]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails