Isopentenyl-diphosphate delta-isomerase

Details

Name
Isopentenyl-diphosphate delta-isomerase
Synonyms
  • 5.3.3.2
  • IDI-2
  • IPP isomerase
  • Isopentenyl diphosphate:dimethylallyl diphosphate isomerase
  • Isopentenyl pyrophosphate isomerase
  • Type 2 isopentenyl diphosphate isomerase
Gene Name
fni
Organism
Thermus thermophilus (strain HB27 / ATCC BAA-163 / DSM 7039)
Amino acid sequence
>lcl|BSEQ0016967|Isopentenyl-diphosphate delta-isomerase
MNIRERKRKHLEACLEGEVAYQKTTTGLEGFRLRYQALAGLALGEVDLTTPFLGKTLKAP
FLIGAMTGGEENGERINLALAEAAEALGVGMMLGSGRILLERPEALRSFRVRKVAPKALL
IANLGLAQLRRYGRDDLLRLVEALEADALAFHVNPLQEAVQRGDTDFRGLVERLAELLPL
PFPVMVKEVGHGLSREAALALRDLPLAAVDVAGAGGTSWARVEEWVRFGEVRHPELCEIG
IPTARAILEVREVLPHLPLVASGGVYTGTDGAKALALGADLLAVARPLLRPALEGAERVA
AWIGDYLEELRTALFAIGAKNPKEARGRVERV
Number of residues
332
Molecular Weight
35900.305
Theoretical pI
7.07
GO Classification
Functions
FMN binding / isopentenyl-diphosphate delta-isomerase activity / magnesium ion binding / NADPH binding / oxidoreductase activity
Processes
isoprenoid biosynthetic process
Components
cytoplasm
General Function
Oxidoreductase activity
Specific Function
Involved in the biosynthesis of isoprenoids. Catalyzes the 1,3-allylic rearrangement of the homoallylic substrate isopentenyl (IPP) to its allylic isomer, dimethylallyl diphosphate (DMAPP).
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm
Gene sequence
>lcl|BSEQ0016968|Isopentenyl-diphosphate delta-isomerase (fni)
GTGAACATCCGGGAGAGGAAGCGGAAGCACCTCGAGGCCTGCCTGGAAGGCGAGGTGGCC
TACCAGAAGACCACCACGGGGCTGGAAGGCTTCCGCCTCCGCTACCAGGCCCTGGCGGGC
CTCGCCCTAGGCGAGGTGGACCTCACCACCCCCTTCCTGGGGAAGACCCTGAAGGCCCCC
TTCCTCATCGGGGCCATGACCGGGGGGGAGGAAAACGGGGAGAGGATCAACCTGGCCCTG
GCGGAGGCCGCGGAGGCCTTAGGGGTGGGGATGATGCTGGGCTCGGGCAGGATCCTTCTG
GAGCGCCCCGAGGCCCTAAGGAGCTTCCGGGTGCGGAAGGTGGCCCCAAAGGCGCTCCTC
ATCGCCAACCTGGGCCTCGCCCAGCTCAGGCGCTACGGGCGGGACGACCTCCTCCGGCTC
GTGGAGGCCCTGGAGGCGGACGCCCTCGCCTTCCACGTGAACCCCCTGCAGGAGGCGGTG
CAGCGGGGGGACACGGACTTCCGGGGCCTGGTGGAGAGGCTCGCCGAACTCCTCCCCCTC
CCCTTCCCCGTGATGGTGAAGGAGGTGGGGCACGGCCTCTCCCGGGAGGCGGCCTTGGCC
CTACGGGACCTCCCCTTGGCGGCGGTGGACGTGGCCGGGGCCGGGGGGACGAGCTGGGCC
CGGGTGGAGGAGTGGGTGCGCTTCGGGGAGGTGCGCCACCCGGAGCTCTGCGAGATCGGG
ATCCCCACGGCGAGGGCCATCCTCGAGGTGCGGGAGGTCCTGCCCCACCTCCCCCTCGTG
GCCTCCGGCGGGGTCTACACGGGGACGGACGGGGCCAAGGCCCTGGCCCTGGGGGCGGAC
CTCTTGGCGGTGGCGCGCCCCCTCCTCAGGCCCGCCCTGGAGGGGGCGGAAAGGGTGGCG
GCCTGGATCGGGGACTACCTGGAAGAACTTAGGACCGCCCTCTTCGCCATCGGGGCCAAG
AACCCGAAGGAAGCCCGGGGGCGGGTGGAGCGGGTGTAG
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ746I8
UniProtKB Entry NameIDI2_THET2
GenBank Gene IDAE017222
General References
  1. Henne A, Bruggemann H, Raasch C, Wiezer A, Hartsch T, Liesegang H, Johann A, Lienard T, Gohl O, Martinez-Arias R, Jacobi C, Starkuviene V, Schlenczeck S, Dencker S, Huber R, Klenk HP, Kramer W, Merkl R, Gottschalk G, Fritz HJ: The genome sequence of the extreme thermophile Thermus thermophilus. Nat Biotechnol. 2004 May;22(5):547-53. Epub 2004 Apr 4. [PubMed:15064768]
  2. Rothman SC, Helm TR, Poulter CD: Kinetic and spectroscopic characterization of type II isopentenyl diphosphate isomerase from Thermus thermophilus: evidence for formation of substrate-induced flavin species. Biochemistry. 2007 May 8;46(18):5437-45. Epub 2007 Apr 12. [PubMed:17428035]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB03247Flavin mononucleotideapproved, investigationalunknownDetails