Glycosyltransferase 6 domain-containing protein 1

Details

Name
Glycosyltransferase 6 domain-containing protein 1
Synonyms
  • 2.4.1.-
  • Galactosyltransferase family 6 domain-containing 1
  • GLTDC1
  • GT6M7
Gene Name
GLT6D1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0019580|Glycosyltransferase 6 domain-containing protein 1
MNSKRMLLLVLFAFSLMLVERYFRNHQVEELRLSDWFHPRKRPDVITKTDWLAPVLWEGT
FDRRVLEKHYRRRNITVGLAVFATGRFAEEYLRPFLHSANKHFMTGYRVIFYIMVDAFFK
LPDIEPSPLRTFKAFKVGTERWWLDGPLVHVKSLGEHIASHIQDEVDFLFSMAANQVFQN
EFGVETLGPLVAQLHAWWYFRNTKNFPYERRPTSAACIPFGQGDFYYGNLMVGGTPHNIL
DFIKEYLNGVIHDIKNGLNSTYEKHLNKYFYLNKPTKLLSPAYSWDLAFSPPPQIQYVKV
AHDSQRKL
Number of residues
308
Molecular Weight
36273.575
Theoretical pI
Not Available
GO Classification
Functions
transferase activity, transferring hexosyl groups
Processes
carbohydrate metabolic process
Components
integral component of membrane
General Function
Transferase activity, transferring hexosyl groups
Specific Function
Not Available
Pfam Domain Function
Transmembrane Regions
7-23
Cellular Location
Membrane
Gene sequence
>lcl|BSEQ0019581|Glycosyltransferase 6 domain-containing protein 1 (GLT6D1)
ATGAATTCTAAAAGAATGCTGTTATTGGTTTTATTTGCTTTTTCACTGATGTTGGTTGAG
CGTTATTTCAGGAATCACCAAGTAGAAGAACTTCGGCTCTCAGACTGGTTTCATCCTAGA
AAACGCCCTGATGTTATAACGAAAACAGACTGGCTCGCTCCTGTCCTATGGGAAGGGACT
TTCGACAGGCGGGTCCTGGAAAAACATTACAGAAGGCGGAATATCACTGTGGGCCTGGCC
GTCTTTGCTACTGGCAGGTTTGCAGAGGAGTACCTGAGGCCGTTCCTACACTCCGCAAAT
AAGCACTTCATGACAGGCTACCGAGTGATCTTCTACATCATGGTGGACGCCTTCTTCAAG
CTGCCTGACATAGAGCCCAGTCCTCTTCGAACGTTCAAAGCATTTAAAGTGGGCACCGAG
AGGTGGTGGCTCGATGGCCCCCTGGTGCATGTGAAGAGCCTGGGTGAACACATCGCCAGT
CACATCCAGGACGAGGTGGACTTCCTCTTCAGCATGGCTGCCAACCAGGTCTTCCAGAAT
GAGTTCGGGGTGGAGACCCTGGGCCCGTTGGTGGCCCAGCTCCACGCCTGGTGGTATTTC
AGAAACACCAAGAACTTCCCTTATGAGAGGAGGCCGACCTCAGCAGCTTGCATCCCGTTT
GGACAGGGAGATTTCTATTATGGCAACTTGATGGTTGGTGGCACACCCCATAATATTTTA
GACTTCATCAAAGAATATCTGAACGGAGTTATTCATGACATCAAAAATGGACTCAATAGC
ACTTATGAAAAGCACCTTAACAAATATTTTTACCTCAATAAACCCACCTAG
Chromosome Location
9
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ7Z4J2
UniProtKB Entry NameGL6D1_HUMAN
HGNC IDHGNC:23671
General References
  1. Humphray SJ, Oliver K, Hunt AR, Plumb RW, Loveland JE, Howe KL, Andrews TD, Searle S, Hunt SE, Scott CE, Jones MC, Ainscough R, Almeida JP, Ambrose KD, Ashwell RI, Babbage AK, Babbage S, Bagguley CL, Bailey J, Banerjee R, Barker DJ, Barlow KF, Bates K, Beasley H, Beasley O, Bird CP, Bray-Allen S, Brown AJ, Brown JY, Burford D, Burrill W, Burton J, Carder C, Carter NP, Chapman JC, Chen Y, Clarke G, Clark SY, Clee CM, Clegg S, Collier RE, Corby N, Crosier M, Cummings AT, Davies J, Dhami P, Dunn M, Dutta I, Dyer LW, Earthrowl ME, Faulkner L, Fleming CJ, Frankish A, Frankland JA, French L, Fricker DG, Garner P, Garnett J, Ghori J, Gilbert JG, Glison C, Grafham DV, Gribble S, Griffiths C, Griffiths-Jones S, Grocock R, Guy J, Hall RE, Hammond S, Harley JL, Harrison ES, Hart EA, Heath PD, Henderson CD, Hopkins BL, Howard PJ, Howden PJ, Huckle E, Johnson C, Johnson D, Joy AA, Kay M, Keenan S, Kershaw JK, Kimberley AM, King A, Knights A, Laird GK, Langford C, Lawlor S, Leongamornlert DA, Leversha M, Lloyd C, Lloyd DM, Lovell J, Martin S, Mashreghi-Mohammadi M, Matthews L, McLaren S, McLay KE, McMurray A, Milne S, Nickerson T, Nisbett J, Nordsiek G, Pearce AV, Peck AI, Porter KM, Pandian R, Pelan S, Phillimore B, Povey S, Ramsey Y, Rand V, Scharfe M, Sehra HK, Shownkeen R, Sims SK, Skuce CD, Smith M, Steward CA, Swarbreck D, Sycamore N, Tester J, Thorpe A, Tracey A, Tromans A, Thomas DW, Wall M, Wallis JM, West AP, Whitehead SL, Willey DL, Williams SA, Wilming L, Wray PW, Young L, Ashurst JL, Coulson A, Blocker H, Durbin R, Sulston JE, Hubbard T, Jackson MJ, Bentley DR, Beck S, Rogers J, Dunham I: DNA sequence and analysis of human chromosome 9. Nature. 2004 May 27;429(6990):369-74. [PubMed:15164053]
  2. Schaefer AS, Richter GM, Nothnagel M, Manke T, Dommisch H, Jacobs G, Arlt A, Rosenstiel P, Noack B, Groessner-Schreiber B, Jepsen S, Loos BG, Schreiber S: A genome-wide association study identifies GLT6D1 as a susceptibility locus for periodontitis. Hum Mol Genet. 2010 Feb 1;19(3):553-62. doi: 10.1093/hmg/ddp508. Epub 2009 Nov 6. [PubMed:19897590]
  3. Casals F, Ferrer-Admetlla A, Sikora M, Ramirez-Soriano A, Marques-Bonet T, Despiau S, Roubinet F, Calafell F, Bertranpetit J, Blancher A: Human pseudogenes of the ABO family show a complex evolutionary dynamics and loss of function. Glycobiology. 2009 Jun;19(6):583-91. doi: 10.1093/glycob/cwp017. Epub 2009 Feb 13. [PubMed:19218399]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB03435Uridine-5'-DiphosphateexperimentalunknownDetails
DB03685Uridine monophosphateexperimentalunknownDetails
DB02379Beta-D-GlucoseexperimentalunknownDetails
DB01861Uridine diphosphate glucoseexperimentalunknownDetails
DB04465Lactoseapproved, experimental, investigationalunknownDetails