Sodium channel subunit beta-4
Details
- Name
- Sodium channel subunit beta-4
- Synonyms
- Not Available
- Gene Name
- SCN4B
- UniProtKB Entry
- Q8IWT1Swiss-Prot
- Organism
- Humans
- NCBI Taxonomy ID
- 9606
- Amino acid sequence
>lcl|BSEQ0006993|Sodium channel subunit beta-4 MPGAGDGGKAPARWLGTGLLGLFLLPVTLSLEVSVGKATDIYAVNGTEILLPCTFSSCFG FEDLHFRWTYNSSDAFKILIEGTVKNEKSDPKVTLKDDDRITLVGSTKEKMNNISIVLRD LEFSDTGKYTCHVKNPKENNLQHHATIFLQVVDRLEEVDNTVTLIILAVVGGVIGLLILI LLIKKLIIFILKKTREKKKECLVSSSGNDNTENGLPGSKAEEKPPSKV
- Number of residues
- 228
- Molecular Weight
- 24968.755
- Theoretical pI
- 7.45
- GO Classification
- Functionstransmembrane transporter bindingProcessesestablishment of localization in cell / neuronal action potentialComponentsplasma membrane
- General Function
- Modulates channel gating kinetics. Causes negative shifts in the voltage dependence of activation of certain alpha sodium channels, but does not affect the voltage dependence of inactivation. Modulates the susceptibility of the sodium channel to inhibition by toxic peptides from spider, scorpion, wasp and sea anemone venom
- Specific Function
- sodium channel regulator activity
- Pfam Domain Function
- Not Available
- Signal Regions
- 1-30
- Transmembrane Regions
- 163-183
- Cellular Location
- Cell membrane
- Gene sequence
>lcl|BSEQ0017169|Sodium channel subunit beta-4 (SCN4B) ATGCCCGGGGCTGGGGACGGAGGCAAAGCCCCGGCGAGATGGCTGGGCACTGGGCTTTTG GTGGAAGAAGTGGACAACACAGTGACACTCATCATCCTGGCTGTCGTGGGCGGGGTCATC GGGCTCCTCATCCTCATCCTGCTGATCAAGAAACTCATCATCTTCATCCTGAAGAAGACT CGGGAGAAGAAGAAGGAGTGTCTCGTGAGCTCCTCGGGGAATGACAACACGGAGAACGGC TTGCCTGGCTCCAAGGCAGAGGAGAAACCACCTTCAAAAGTGTGA
- Chromosome Location
- 11
- Locus
- 11q23.3
- External Identifiers
Resource Link UniProtKB ID Q8IWT1 UniProtKB Entry Name SCN4B_HUMAN GenBank Protein ID 27465047 GenBank Gene ID AY149967 GeneCard ID SCN4B HGNC ID HGNC:10592 PDB ID(s) 4MZ2, 4MZ3, 5XAW, 6VSV, 7DTD KEGG ID hsa:6330 NCBI Gene ID 6330 - General References
- Yu FH, Westenbroek RE, Silos-Santiago I, McCormick KA, Lawson D, Ge P, Ferriera H, Lilly J, DiStefano PS, Catterall WA, Scheuer T, Curtis R: Sodium channel beta4, a new disulfide-linked auxiliary subunit with similarity to beta2. J Neurosci. 2003 Aug 20;23(20):7577-85. [Article]
- Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES, Sakaki Y: Human chromosome 11 DNA sequence and analysis including novel gene identification. Nature. 2006 Mar 23;440(7083):497-500. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Gilchrist J, Das S, Van Petegem F, Bosmans F: Crystallographic insights into sodium-channel modulation by the beta4 subunit. Proc Natl Acad Sci U S A. 2013 Dec 17;110(51):E5016-24. doi: 10.1073/pnas.1314557110. Epub 2013 Dec 2. [Article]
- Medeiros-Domingo A, Kaku T, Tester DJ, Iturralde-Torres P, Itty A, Ye B, Valdivia C, Ueda K, Canizales-Quinteros S, Tusie-Luna MT, Makielski JC, Ackerman MJ: SCN4B-encoded sodium channel beta4 subunit in congenital long-QT syndrome. Circulation. 2007 Jul 10;116(2):134-42. Epub 2007 Jun 25. [Article]
- Olesen MS, Jespersen T, Nielsen JB, Liang B, Moller DV, Hedley P, Christiansen M, Varro A, Olesen SP, Haunso S, Schmitt N, Svendsen JH: Mutations in sodium channel beta-subunit SCN3B are associated with early-onset lone atrial fibrillation. Cardiovasc Res. 2011 Mar 1;89(4):786-93. doi: 10.1093/cvr/cvq348. Epub 2010 Nov 4. [Article]
- Li RG, Wang Q, Xu YJ, Zhang M, Qu XK, Liu X, Fang WY, Yang YQ: Mutations of the SCN4B-encoded sodium channel beta4 subunit in familial atrial fibrillation. Int J Mol Med. 2013 Jul;32(1):144-50. doi: 10.3892/ijmm.2013.1355. Epub 2013 Apr 22. [Article]
Associated Data
- Bio-Entities
Bio-Entity Type Sodium channel subunit beta-4 (Humans) protein primarySodium channel protein (Humans) protein - Drug Relations
Drug Drug group Pharmacological action? Type Actions Details Zonisamide approved, investigational yes target inhibitor Details Cocaine approved, illicit yes target inhibitor Details Valproic acid approved, investigational unknown target inhibitor Details Brivaracetam approved, investigational yes target inhibitor Details Fish oil approved, nutraceutical unknown target inhibitor Details Dichlorobenzyl alcohol approved yes target antagonist Details Ranolazine approved, investigational unknown target inhibitor Details Oxcarbazepine approved unknown target inhibitor Details