Voltage-dependent calcium channel gamma-8 subunit

Details

Name
Voltage-dependent calcium channel gamma-8 subunit
Synonyms
  • CACNG6
  • Neuronal voltage-gated calcium channel gamma-8 subunit
  • TARP gamma-8
  • Transmembrane AMPAR regulatory protein gamma-8
Gene Name
CACNG8
Organism
Humans
Amino acid sequence
>lcl|BSEQ0051566|Voltage-dependent calcium channel gamma-8 subunit
MESLKRWNEERGLWCEKGVQVLLTTVGAFAAFGLMTIAISTDYWLYTRALICNTTNLTAG
GDDGTPHRGGGGASEKKDPGGLTHSGLWRICCLEGLKRGVCVKINHFPEDTDYDHDSAEY
LLRVVRASSIFPILSAILLLLGGVCVAASRVYKSKRNIILGAGILFVAAGLSNIIGVIVY
ISANAGEPGPKRDEEKKNHYSYGWSFYFGGLSFILAEVIGVLAVNIYIERSREAHCQSRS
DLLKAGGGAGGSGGSGPSAILRLPSYRFRYRRRSRSSSRSSEPSPSRDASPGGPGGPGFA
STDISMYTLSRDPSKGSVAAGLAGAGGGGGGAVGAFGGAAGGAGGGGGGGGGAGAERDRG
GASGFLTLHNAFPKEAGGGVTVTVTGPPAPPAPAPPAPSAPAPGTLAKEAAASNTNTLNR
KTTPV
Number of residues
425
Molecular Weight
43312.44
Theoretical pI
Not Available
GO Classification
Functions
channel regulator activity / voltage-gated calcium channel activity
Processes
calcium ion transmembrane transport / calcium ion transport / cardiac conduction / regulation of AMPA receptor activity / transmission of nerve impulse
Components
AMPA glutamate receptor complex / cell junction / endocytic vesicle membrane / plasma membrane / postsynaptic density / postsynaptic membrane / voltage-gated calcium channel complex
General Function
Regulates the trafficking and gating properties of AMPA-selective glutamate receptors (AMPARs). Promotes their targeting to the cell membrane and synapses and modulates their gating properties by slowing their rates of activation, deactivation and desensitization and by mediating their resensitization. Does not show subunit-specific AMPA receptor regulation and regulates all AMPAR subunits. Thought to stabilize the calcium channel in an inactivated (closed) state.
Specific Function
Channel regulator activity
Pfam Domain Function
Transmembrane Regions
19-39 129-149 158-178 208-228 318-338
Cellular Location
Membrane
Gene sequence
>lcl|BSEQ0051567|Voltage-dependent calcium channel gamma-8 subunit (CACNG8)
CTGGAGTCGCTGAAGCGCTGGAACGAAGAGCGGGGCCTCTGGTGCGAGAAGGGGGTGCAG
GTGCTGCTGACGACGGTGGGCGCCTTCGCCGCCTTCGGCCTCATGACCATCGCCATCAGC
ACTGACTACTGGCTCTACACGCGCGCCCTCATCTGCAACACCACCAACCTCACGGCCGGC
GGCGACGACGGGACCCCCCACCGCGGGGGCGGCGGCGCCTCGGAGAAGAAGGACCCCGGC
GGCCTCACGCACTCGGGCCTCTGGAGGATCTGCTGCCTGGAAGGGTTGAAAAGAGGCGTC
TGCGTGAAGATCAATCATTTCCCGGAGGACACGGACTACGACCACGACAGCGCGGAGTAT
CTACTCCGAGTTGTCCGGGCCTCCAGCATCTTCCCCATCCTTAGCGCCATCCTGCTGCTG
CTCGGGGGTGTGTGCGTGGCGGCCTCCCGCGTCTACAAGTCCAAGAGGAACATCATTCTG
GGCGCAGGGATCCTGTTCGTGGCAGCAGGCCTGAGCAACATCATCGGCGTGATCGTGTAC
ATCTCCGCCAACGCGGGCGAGCCGGGCCCGAAGCGGGACGAGGAGAAGAAAAACCACTAC
TCGTACGGCTGGTCCTTCTACTTCGGCGGGCTGTCGTTCATCCTGGCCGAGGTGATAGGC
GTGCTGGCCGTCAACATCTACATCGAGCGCAGCCGCGAGGCGCACTGCCAGTCTCGCTCG
GACCTGCTCAAGGCCGGCGGGGGCGCGGGCGGCAGTGGCGGGAGCGGCCCCTCGGCCATC
CTCCGTCTGCCCAGTTACCGCTTCCGCTACCGCCGCCGCTCCCGCTCTAGCTCCCGCTCC
AGCGAGCCGTCGCCGTCGCGGGACGCGTCTCCCGGCGGCCCCGGGGGCCCGGGCTTTGCC
TCCACGGACATCTCCATGTACACGCTCAGCCGCGACCCCTCCAAGGGCAGCGTGGCCGCG
GGGCTGGCGGGGGCCGGCGGCGGCGGCGGCGGCGCCGTGGGGGCGTTCGGCGGCGCGGCC
GGGGGCGCCGGGGGCGGCGGCGGAGGCGGCGGCGGGGCGGGTGCCGAGCGGGACCGCGGG
GGGGCGTCCGGCTTCCTCACGCTGCACAACGCCTTCCCCAAGGAGGCGGGCGGCGGCGTC
ACGGTCACGGTCACCGGGCCGCCCGCCCCGCCCGCGCCCGCGCCACCCGCGCCCTCTGCG
CCCGCCCCCGGGACCCTGGCCAAGGAGGCCGCCGCCTCCAACACCAACACGCTCAACAGG
AAAACCACGCCTGTGTAG
Chromosome Location
19
Locus
19q13.42
External Identifiers
ResourceLink
UniProtKB IDQ8WXS5
UniProtKB Entry NameCCG8_HUMAN
HGNC IDHGNC:13628
General References
  1. Chu PJ, Robertson HM, Best PM: Calcium channel gamma subunits provide insights into the evolution of this gene family. Gene. 2001 Dec 12;280(1-2):37-48. [Article]
  2. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. [Article]
  3. Burgess DL, Gefrides LA, Foreman PJ, Noebels JL: A cluster of three novel Ca2+ channel gamma subunit genes on chromosome 19q13.4: evolution and expression profile of the gamma subunit gene family. Genomics. 2001 Feb 1;71(3):339-50. [Article]
  4. Kato AS, Gill MB, Ho MT, Yu H, Tu Y, Siuda ER, Wang H, Qian YW, Nisenbaum ES, Tomita S, Bredt DS: Hippocampal AMPA receptor gating controlled by both TARP and cornichon proteins. Neuron. 2010 Dec 22;68(6):1082-96. doi: 10.1016/j.neuron.2010.11.026. [Article]
  5. Shi Y, Suh YH, Milstein AD, Isozaki K, Schmid SM, Roche KW, Nicoll RA: Functional comparison of the effects of TARPs and cornichons on AMPA receptor trafficking and gating. Proc Natl Acad Sci U S A. 2010 Sep 14;107(37):16315-9. doi: 10.1073/pnas.1011706107. Epub 2010 Aug 30. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00421SpironolactoneapprovedunknowninhibitorDetails
DB11148Butambenapproved, withdrawnyesinhibitorDetails
DB13746Bioallethrinapproved, experimentalunknownagonistDetails
DB00153Ergocalciferolapproved, nutraceuticalnoinducerDetails
DB00228Enfluraneapproved, investigational, vet_approvedyesinhibitoractivatorDetails