Phosphatidylinositol 3-kinase regulatory subunit gamma

Details

Name
Phosphatidylinositol 3-kinase regulatory subunit gamma
Synonyms
  • p55PIK
  • Phosphatidylinositol 3-kinase 55 kDa regulatory subunit gamma
  • PI3-kinase regulatory subunit gamma
  • PI3-kinase subunit p55-gamma
  • PtdIns-3-kinase regulatory subunit p55-gamma
Gene Name
PIK3R3
Organism
Humans
Amino acid sequence
>lcl|BSEQ0037200|Phosphatidylinositol 3-kinase regulatory subunit gamma
MYNTVWSMDRDDADWREVMMPYSTELIFYIEMDPPALPPKPPKPMTSAVPNGMKDSSVSL
QDAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTLRKGGNNKLIKIYHRDG
KYGFSDPLTFNSVVELINHYHHESLAQYNPKLDVKLMYPVSRYQQDQLVKEDNIDAVGKK
LQEYHSQYQEKSKEYDRLYEEYTRTSQEIQMKRTAIEAFNETIKIFEEQCHTQEQHSKEY
IERFRREGNEKEIERIMMNYDKLKSRLGEIHDSKMRLEQDLKNQALDNREIDKKMNSIKP
DLIQLRKIRDQHLVWLNHKGVRQKRLNVWLGIKNEDADENYFINEEDENLPHYDEKTWFV
EDINRVQAEDLLYGKPDGAFLIRESSKKGCYACSVVADGEVKHCVIYSTARGYGFAEPYN
LYSSLKELVLHYQQTSLVQHNDSLNVRLAYPVHAQMPSLCR
Number of residues
461
Molecular Weight
54448.0
Theoretical pI
6.02
GO Classification
Functions
1-phosphatidylinositol-3-kinase activity / 1-phosphatidylinositol-3-kinase regulator activity
Processes
insulin receptor signaling pathway / phosphatidylinositol biosynthetic process / phosphatidylinositol phosphorylation / phosphatidylinositol-3-phosphate biosynthetic process / phospholipid metabolic process / positive regulation of glucose import in response to insulin stimulus / regulation of phosphatidylinositol 3-kinase activity / small molecule metabolic process
Components
cytosol / phosphatidylinositol 3-kinase complex
General Function
1-phosphatidylinositol-3-kinase regulator activity
Specific Function
Binds to activated (phosphorylated) protein-tyrosine kinases through its SH2 domain and regulates their kinase activity. During insulin stimulation, it also binds to IRS-1.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Gene sequence
>lcl|BSEQ0011710|Phosphatidylinositol 3-kinase regulatory subunit gamma (PIK3R3)
ATGTACAATACGGTGTGGAGTATGGACCGCGATGACGCAGACTGGAGGGAGGTGATGATG
CCCTATTCGACAGAACTGATATTTTATATTGAAATGGATCCTCCAGCTCTTCCACCAAAG
CCACCTAAGCCAATGACTTCAGCAGTTCCAAATGGAATGAAGGACAGTTCTGTTTCTCTT
CAGGATGCAGAATGGTACTGGGGGGATATTTCAAGGGAGGAGGTAAATGACAAATTGCGG
GATATGCCAGATGGGACCTTCTTGGTCCGAGATGCCTCAACAAAAATGCAGGGAGATTAT
ACTTTGACTTTGCGGAAGGGAGGCAATAATAAGTTAATAAAGATCTATCACCGGGATGGT
AAATATGGCTTTTCTGATCCTCTGACATTTAATTCCGTGGTGGAGCTCATTAACCACTAT
CACCATGAATCTCTTGCTCAGTACAATCCCAAACTTGATGTGAAGCTGATGTACCCAGTG
TCCAGATACCAACAGGATCAGTTGGTAAAAGAAGATAATATTGATGCAGTAGGTAAAAAA
CTGCAAGAATACCACTCTCAGTATCAGGAGAAGAGTAAAGAGTATGATAGGCTGTATGAA
GAATATACTAGAACATCCCAGGAAATACAGATGAAGAGGACTGCAATAGAAGCTTTTAAT
GAAACAATTAAAATATTTGAAGAGCAGTGTCACACACAAGAACAACATAGCAAAGAATAT
ATTGAGCGATTTCGCAGAGAGGGGAATGAAAAGGAGATTGAACGAATTATGATGAATTAT
GATAAATTGAAATCACGTCTGGGTGAGATTCATGATAGCAAAATGCGTCTAGAGCAGGAT
TTGAAGAATCAAGCTTTGGACAACCGAGAAATAGATAAAAAAATGAATAGCATCAAACCT
GACCTGATCCAGCTGCGAAAGATCCGAGATCAACACCTTGTATGGCTCAATCACAAAGGA
GTGAGACAGAAACGCCTGAATGTCTGGCTGGGAATTAAGAATGAGGATGCTGATGAGAAC
TATTTTATCAATGAGGAAGATGAAAACCTGCCCCATTATGATGAGAAAACCTGGTTTGTT
GAGGATATCAATCGAGTACAAGCAGAGGACTTGCTTTATGGGAAACCTGATGGTGCATTC
TTAATTCGTGAGAGTAGCAAGAAAGGATGCTATGCTTGCTCTGTGGTGGCCGATGGGGAA
GTGAAGCACTGTGTGATCTACAGCACTGCTCGGGGCTATGGCTTTGCAGAGCCCTACAAC
CTGTACAGCTCTCTGAAGGAGCTAGTGCTCCATTACCAGCAGACATCCTTGGTTCAGCAC
AACGACTCCCTCAACGTCAGGCTTGCCTACCCTGTTCATGCACAGATGCCCTCGCTTTGC
AGATAA
Chromosome Location
1
Locus
1p34.1
External Identifiers
ResourceLink
UniProtKB IDQ92569
UniProtKB Entry NameP55G_HUMAN
GenBank Gene IDD88532
GenAtlas IDPIK3R3
HGNC IDHGNC:8981
General References
  1. Dey BR, Furlanetto RW, Nissley SP: Cloning of human p55 gamma, a regulatory subunit of phosphatidylinositol 3-kinase, by a yeast two-hybrid library screen with the insulin-like growth factor-I receptor. Gene. 1998 Mar 16;209(1-2):175-83. [PubMed:9524259]
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  3. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [PubMed:16710414]
  4. Hafizi S, Alindri F, Karlsson R, Dahlback B: Interaction of Axl receptor tyrosine kinase with C1-TEN, a novel C1 domain-containing protein with homology to tensin. Biochem Biophys Res Commun. 2002 Dec 20;299(5):793-800. [PubMed:12470648]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB05210SF1126investigationalunknownDetails