Beta-lactamase
Details
- Name
- Beta-lactamase
- Synonyms
- 3.5.2.6
- bla
- blaKPC
- blaKPC-2
- kpc2
- Gene Name
- KPC-2
- Organism
- Klebsiella pneumoniae
- Amino acid sequence
>lcl|BSEQ0052114|Beta-lactamase MSLYRRLVLLSCLSWPLAGFSATALTNLVAEPFAKLEQDFGGSIGVYAMDTGSGATVSYR AEERFPLCSSFKGFLAAAVLARSQQQAGLLDTPIRYGKNALVPWSPISEKYLTTGMTVAE LSAAAVQYSDNAAANLLLKELGGPAGLTAFMRSIGDTTFRLDRWELELNSAIPGDARDTS SPRAVTESLQKLTLGSALAAPQRQQFVDWLKGNTTGNHRIRAAVPADWAVGDKTGTCGVY GTANDYAVVWPTGRAPIVLAVYTRAPNKDDKHSEAVIAAAARLALEGLGVNGQ
- Number of residues
- 293
- Molecular Weight
- 31114.99
- Theoretical pI
- Not Available
- GO Classification
- Functionsbeta-lactamase activityProcessesbeta-lactam antibiotic catabolic process / response to antibiotic
- General Function
- Not Available
- Specific Function
- Beta-lactamase activity
- Pfam Domain Function
- Not Available
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID Q93LQ9 UniProtKB Entry Name Q93LQ9_KLEPN - General References
- Smith Moland E, Hanson ND, Herrera VL, Black JA, Lockhart TJ, Hossain A, Johnson JA, Goering RV, Thomson KS: Plasmid-mediated, carbapenem-hydrolysing beta-lactamase, KPC-2, in Klebsiella pneumoniae isolates. J Antimicrob Chemother. 2003 Mar;51(3):711-4. [Article]
- Naas T, Nordmann P, Vedel G, Poyart C: Plasmid-mediated carbapenem-hydrolyzing beta-lactamase KPC in a Klebsiella pneumoniae isolate from France. Antimicrob Agents Chemother. 2005 Oct;49(10):4423-4. doi: 10.1128/AAC.49.10.4423-4424.2005. [Article]
- Villegas MV, Lolans K, Correa A, Suarez CJ, Lopez JA, Vallejo M, Quinn JP: First detection of the plasmid-mediated class A carbapenemase KPC-2 in clinical isolates of Klebsiella pneumoniae from South America. Antimicrob Agents Chemother. 2006 Aug;50(8):2880-2. doi: 10.1128/AAC.00186-06. [Article]
- Wei ZQ, Du XX, Yu YS, Shen P, Chen YG, Li LJ: Plasmid-mediated KPC-2 in a Klebsiella pneumoniae isolate from China. Antimicrob Agents Chemother. 2007 Feb;51(2):763-5. doi: 10.1128/AAC.01053-06. Epub 2006 Dec 4. [Article]
- Naas T, Cuzon G, Villegas MV, Lartigue MF, Quinn JP, Nordmann P: Genetic structures at the origin of acquisition of the beta-lactamase bla KPC gene. Antimicrob Agents Chemother. 2008 Apr;52(4):1257-63. doi: 10.1128/AAC.01451-07. Epub 2008 Jan 28. [Article]
- Monteiro J, Santos AF, Asensi MD, Peirano G, Gales AC: First report of KPC-2-producing Klebsiella pneumoniae strains in Brazil. Antimicrob Agents Chemother. 2009 Jan;53(1):333-4. doi: 10.1128/AAC.00736-08. Epub 2008 Nov 17. [Article]
- Gootz TD, Lescoe MK, Dib-Hajj F, Dougherty BA, He W, Della-Latta P, Huard RC: Genetic organization of transposase regions surrounding blaKPC carbapenemase genes on plasmids from Klebsiella strains isolated in a New York City hospital. Antimicrob Agents Chemother. 2009 May;53(5):1998-2004. doi: 10.1128/AAC.01355-08. Epub 2009 Mar 2. [Article]
- Shen P, Wei Z, Jiang Y, Du X, Ji S, Yu Y, Li L: Novel genetic environment of the carbapenem-hydrolyzing beta-lactamase KPC-2 among Enterobacteriaceae in China. Antimicrob Agents Chemother. 2009 Oct;53(10):4333-8. doi: 10.1128/AAC.00260-09. Epub 2009 Jul 20. [Article]
- Jiang Y, Yu D, Wei Z, Shen P, Zhou Z, Yu Y: Complete nucleotide sequence of Klebsiella pneumoniae multidrug resistance plasmid pKP048, carrying blaKPC-2, blaDHA-1, qnrB4, and armA. Antimicrob Agents Chemother. 2010 Sep;54(9):3967-9. doi: 10.1128/AAC.00137-10. Epub 2010 Jun 14. [Article]
- Huang ZM, Mi JR, Sheng YQ, Zou YX, Chu QJ, Ge LW, Yang HY: [Study on pan-resistant Klebsiella pneumoniae harboring blaKPC-2 type carbapenemase gene from a hospital outbreak in Huzhou, Zhejiang]. Zhonghua Liu Xing Bing Xue Za Zhi. 2010 May;31(5):559-62. [Article]
- Gomez SA, Pasteran FG, Faccone D, Tijet N, Rapoport M, Lucero C, Lastovetska O, Albornoz E, Galas M, Melano RG, Corso A, Petroni A: Clonal dissemination of Klebsiella pneumoniae ST258 harbouring KPC-2 in Argentina. Clin Microbiol Infect. 2011 Oct;17(10):1520-4. doi: 10.1111/j.1469-0691.2011.03600.x. Epub 2011 Aug 18. [Article]
- Frasson I, Lavezzo E, Franchin E, Toppo S, Barzon L, Cavallaro A, Richter SN, Palu G: Antimicrobial treatment and containment measures for an extremely drug-resistant Klebsiella pneumoniae ST101 isolate carrying pKPN101-IT, a novel fully sequenced bla(KPC-2) plasmid. J Clin Microbiol. 2012 Nov;50(11):3768-72. doi: 10.1128/JCM.01892-12. Epub 2012 Sep 12. [Article]
- Kassis-Chikhani N, Frangeul L, Drieux L, Sengelin C, Jarlier V, Brisse S, Arlet G, Decre D: Complete nucleotide sequence of the first KPC-2- and SHV-12-encoding IncX plasmid, pKpS90, from Klebsiella pneumoniae. Antimicrob Agents Chemother. 2013 Jan;57(1):618-20. doi: 10.1128/AAC.01712-12. Epub 2012 Oct 22. [Article]
- Chen L, Chavda KD, Melano RG, Jacobs MR, Levi MH, Bonomo RA, Kreiswirth BN: Complete sequence of a bla(KPC-2)-harboring IncFII(K1) plasmid from a Klebsiella pneumoniae sequence type 258 strain. Antimicrob Agents Chemother. 2013 Mar;57(3):1542-5. doi: 10.1128/AAC.02332-12. Epub 2013 Jan 7. [Article]
- Papagiannitsis CC, Miriagou V, Giakkoupi P, Tzouvelekis LS, Vatopoulos AC: Characterization of pKP1433, a novel KPC-2-encoding plasmid from Klebsiella pneumoniae sequence type 340. Antimicrob Agents Chemother. 2013 Jul;57(7):3427-9. doi: 10.1128/AAC.00054-13. Epub 2013 Apr 29. [Article]
- Ho PL, Cheung YY, Lo WU, Li Z, Chow KH, Lin CH, Chan JF, Cheng VC: Molecular Characterization of an Atypical IncX3 Plasmid pKPC-NY79 Carrying bla KPC-2 in a Klebsiella pneumoniae. Curr Microbiol. 2013 Oct;67(4):493-8. doi: 10.1007/s00284-013-0398-2. Epub 2013 Jun 1. [Article]
- Roth AL, Lister PD, Hanson ND: Effect of drug treatment options on the mobility and expression of blaKPC. J Antimicrob Chemother. 2013 Dec;68(12):2779-85. doi: 10.1093/jac/dkt280. Epub 2013 Jul 16. [Article]
- Chen L, Chavda KD, Melano RG, Jacobs MR, Koll B, Hong T, Rojtman AD, Levi MH, Bonomo RA, Kreiswirth BN: Comparative genomic analysis of KPC-encoding pKpQIL-like plasmids and their distribution in New Jersey and New York Hospitals. Antimicrob Agents Chemother. 2014 May;58(5):2871-7. doi: 10.1128/AAC.00120-14. Epub 2014 Mar 10. [Article]
- Saito R, Takahashi R, Sawabe E, Koyano S, Takahashi Y, Shima M, Ushizawa H, Fujie T, Tosaka N, Kato Y, Moriya K, Tohda S, Tojo N, Koike R, Kubota T: First report of KPC-2 Carbapenemase-producing Klebsiella pneumoniae in Japan. Antimicrob Agents Chemother. 2014 May;58(5):2961-3. doi: 10.1128/AAC.02072-13. Epub 2014 Feb 24. [Article]
- Hazen TH, Zhao L, Boutin MA, Stancil A, Robinson G, Harris AD, Rasko DA, Johnson JK: Comparative genomics of an IncA/C multidrug resistance plasmid from Escherichia coli and Klebsiella isolates from intensive care unit patients and the utility of whole-genome sequencing in health care settings. Antimicrob Agents Chemother. 2014 Aug;58(8):4814-25. doi: 10.1128/AAC.02573-14. Epub 2014 Jun 9. [Article]
- Chen YT, Lin JC, Fung CP, Lu PL, Chuang YC, Wu TL, Siu LK: KPC-2-encoding plasmids from Escherichia coli and Klebsiella pneumoniae in Taiwan. J Antimicrob Chemother. 2014 Mar;69(3):628-31. doi: 10.1093/jac/dkt409. Epub 2013 Oct 11. [Article]
- Garbari L, Busetti M, Dolzani L, Petix V, Knezevich A, Bressan R, Gionechetti F, Tonin EA, Lagatolla C: pKBuS13, a KPC-2-encoding plasmid from Klebsiella pneumoniae sequence type 833, carrying Tn4401b inserted into an Xer site-specific recombination locus. Antimicrob Agents Chemother. 2015 Sep;59(9):5226-31. doi: 10.1128/AAC.04543-14. Epub 2015 Jun 15. [Article]
- Wang L, Fang H, Feng J, Yin Z, Xie X, Zhu X, Wang J, Chen W, Yang R, Du H, Zhou D: Complete sequences of KPC-2-encoding plasmid p628-KPC and CTX-M-55-encoding p628-CTXM coexisted in Klebsiella pneumoniae. Front Microbiol. 2015 Aug 19;6:838. doi: 10.3389/fmicb.2015.00838. eCollection 2015. [Article]
- Sonnevend A, Ghazawi A, Darwish D, AlDeesi Z, Kadhum AF, Pal T: Characterization of KPC-type carbapenemase-producing Klebsiella pneumoniae strains isolated in the Arabian Peninsula. J Antimicrob Chemother. 2015 May;70(5):1592-3. doi: 10.1093/jac/dku576. Epub 2015 Jan 20. [Article]
- Papagiannitsis CC, Di Pilato V, Giani T, Giakkoupi P, Riccobono E, Landini G, Miriagou V, Vatopoulos AC, Rossolini GM: Characterization of KPC-encoding plasmids from two endemic settings, Greece and Italy. J Antimicrob Chemother. 2016 Oct;71(10):2824-30. doi: 10.1093/jac/dkw227. Epub 2016 Jun 21. [Article]
- Tamma PD, Fan Y, Bergman Y, Pertea G, Kazmi AQ, Lewis S, Carroll KC, Schatz MC, Timp W, Simner PJ: Applying Rapid Whole-Genome Sequencing To Predict Phenotypic Antimicrobial Susceptibility Testing Results among Carbapenem-Resistant Klebsiella pneumoniae Clinical Isolates. Antimicrob Agents Chemother. 2018 Dec 21;63(1). pii: AAC.01923-18. doi: 10.1128/AAC.01923-18. Print 2019 Jan. [Article]
- Weingarten RA, Johnson RC, Conlan S, Ramsburg AM, Dekker JP, Lau AF, Khil P, Odom RT, Deming C, Park M, Thomas PJ, Henderson DK, Palmore TN, Segre JA, Frank KM: Genomic Analysis of Hospital Plumbing Reveals Diverse Reservoir of Bacterial Plasmids Conferring Carbapenem Resistance. MBio. 2018 Feb 6;9(1). pii: mBio.02011-17. doi: 10.1128/mBio.02011-17. [Article]