Protein S100-A13

Details

Name
Protein S100-A13
Synonyms
  • S100 calcium-binding protein A13
Gene Name
S100A13
Organism
Humans
Amino acid sequence
>lcl|BSEQ0016239|Protein S100-A13
MAAEPLTELEESIETVVTTFFTFARQEGRKDSLSVNEFKELVTQQLPHLLKDVGSLDEKM
KSLDVNQDSELKFNEYWRLIGELAKEIRKKKDLKIRKK
Number of residues
98
Molecular Weight
11471.095
Theoretical pI
5.96
GO Classification
Functions
calcium ion binding / copper ion binding / fibroblast growth factor binding / lipid binding / protein homodimerization activity / RAGE receptor binding / zinc ion binding
Processes
cytokine secretion / interleukin-1 alpha secretion / mast cell degranulation / positive regulation of cell proliferation / positive regulation of I-kappaB kinase/NF-kappaB signaling / regulation of cell shape / response to copper ion / response to electrical stimulus
Components
cytoplasm / cytosol / extracellular exosome / extracellular space / mast cell granule / nucleus / perinuclear region of cytoplasm
General Function
Zinc ion binding
Specific Function
Plays a role in the export of proteins that lack a signal peptide and are secreted by an alternative pathway. Binds two calcium ions per subunit. Binds one copper ion. Binding of one copper ion does not interfere with calcium binding. Required for the copper-dependent stress-induced export of IL1A and FGF1. The calcium-free protein binds to lipid vesicles containing phosphatidylserine, but not to vesicles containing phosphatidylcholine (By similarity).
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm
Gene sequence
>lcl|BSEQ0016240|Protein S100-A13 (S100A13)
ATGGCAGCAGAACCACTGACAGAGCTAGAGGAGTCCATTGAGACCGTGGTCACCACCTTC
TTCACCTTTGCAAGGCAGGAGGGCCGGAAGGATAGCCTCAGCGTCAACGAGTTCAAAGAG
CTGGTTACCCAGCAGTTGCCCCATCTGCTCAAGGATGTGGGCTCTCTTGATGAGAAGATG
AAGAGCTTGGATGTGAATCAGGACTCGGAGCTCAAGTTCAATGAGTACTGGAGATTGATT
GGGGAGCTGGCCAAGGAAATCAGGAAGAAGAAAGACCTGAAGATCAGGAAGAAGTAA
Chromosome Location
1
Locus
1q21
External Identifiers
ResourceLink
UniProtKB IDQ99584
UniProtKB Entry NameS10AD_HUMAN
GenBank Protein ID1694828
GenBank Gene IDX99920
GenAtlas IDS100A13
HGNC IDHGNC:10490
General References
  1. Wicki R, Schafer BW, Erne P, Heizmann CW: Characterization of the human and mouse cDNAs coding for S100A13, a new member of the S100 protein family. Biochem Biophys Res Commun. 1996 Oct 14;227(2):594-9. [Article]
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [Article]
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
  4. Mandinova A, Soldi R, Graziani I, Bagala C, Bellum S, Landriscina M, Tarantini F, Prudovsky I, Maciag T: S100A13 mediates the copper-dependent stress-induced release of IL-1alpha from both human U937 and murine NIH 3T3 cells. J Cell Sci. 2003 Jul 1;116(Pt 13):2687-96. Epub 2003 May 13. [Article]
  5. Cao R, Yan B, Yang H, Zu X, Wen G, Zhong J: Effect of human S100A13 gene silencing on FGF-1 transportation in human endothelial cells. J Formos Med Assoc. 2010 Sep;109(9):632-40. doi: 10.1016/S0929-6646(10)60103-9. [Article]
  6. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [Article]
  7. Arnesano F, Banci L, Bertini I, Fantoni A, Tenori L, Viezzoli MS: Structural interplay between calcium(II) and copper(II) binding to S100A13 protein. Angew Chem Int Ed Engl. 2005 Oct 7;44(39):6341-4. [Article]
  8. Li M, Zhang PF, Pan XW, Chang WR: Crystal structure study on human S100A13 at 2.0 A resolution. Biochem Biophys Res Commun. 2007 May 11;356(3):616-21. Epub 2007 Mar 12. [Article]
  9. Imai FL, Nagata K, Yonezawa N, Nakano M, Tanokura M: Structure of calcium-bound human S100A13 at pH 7.5 at 1.8 A resolution. Acta Crystallogr Sect F Struct Biol Cryst Commun. 2008 Feb 1;64(Pt 2):70-6. doi: 10.1107/S1744309107068236. Epub 2008 Jan 31. [Article]
  10. Mohan SK, Rani SG, Kumar SM, Yu C: S100A13-C2A binary complex structure-a key component in the acidic fibroblast growth factor for the non-classical pathway. Biochem Biophys Res Commun. 2009 Mar 13;380(3):514-9. doi: 10.1016/j.bbrc.2009.01.143. Epub 2009 Jan 29. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01025Amlexanoxapproved, investigational, withdrawnunknownantagonistDetails
DB00768Olopatadineapprovedunknownother/unknownDetails
DB11093Calcium citrateapproved, investigationalnoligandDetails
DB11348Calcium PhosphateapprovednoligandDetails
DB01373CalciumnutraceuticalunknownDetails
DB01164Calcium chlorideapprovedunknownDetails
DB14481Calcium phosphate dihydrateapprovednoDetails