Beta-lactamase UOE-1
Details
- Name
- Beta-lactamase UOE-1
- Synonyms
- Not Available
- Gene Name
- blaUOE-1
- Organism
- Escherichia coli
- Amino acid sequence
>lcl|BSEQ0049130|Beta-lactamase UOE-1 MVKKSLRQFTLMATATVTLLLGSVPLYAQTADVQQKLAELERQSGGRLGVALINTADNSQ ILYRADERFAMCSTSKVMAAAAVLKKSESEPNLLNQRVEIKKSDLVNYNPIAEKHVNGTM SLAELSAAALQYSDNVAMNKLIAHVGGPASVTAFARQLGDETFRLDRTEPTLNTAIPGDP RDTTSPRAMAQTLRNLTLGKALGDSQRAQLVTWMKGNTTGAASIQAGLPASWVVGDKTGS GGYGTTNDIAVIWPKDRAPLILVTYFTQPQPKAESRRDVLASAAKIVTDGL
- Number of residues
- 291
- Molecular Weight
- 31143.3
- Theoretical pI
- Not Available
- GO Classification
- Functionsbeta-lactamase activityProcessesbeta-lactam antibiotic catabolic process / response to antibiotic
- General Function
- Beta-lactamase activity
- Specific Function
- Not Available
- Pfam Domain Function
- Not Available
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID Q9EXV5 UniProtKB Entry Name Q9EXV5_ECOLX - General References
- Lahiri SD, Mangani S, Durand-Reville T, Benvenuti M, De Luca F, Sanyal G, Docquier JD: Structural insight into potent broad-spectrum inhibition with reversible recyclization mechanism: avibactam in complex with CTX-M-15 and Pseudomonas aeruginosa AmpC beta-lactamases. Antimicrob Agents Chemother. 2013 Jun;57(6):2496-505. doi: 10.1128/AAC.02247-12. Epub 2013 Feb 25. [Article]
- King AM, King DT, French S, Brouillette E, Asli A, Alexander JA, Vuckovic M, Maiti SN, Parr TR Jr, Brown ED, Malouin F, Strynadka NC, Wright GD: Structural and Kinetic Characterization of Diazabicyclooctanes as Dual Inhibitors of Both Serine-beta-Lactamases and Penicillin-Binding Proteins. ACS Chem Biol. 2016 Apr 15;11(4):864-8. doi: 10.1021/acschembio.5b00944. Epub 2016 Jan 14. [Article]