STE20-like serine/threonine-protein kinase

Details

Name
STE20-like serine/threonine-protein kinase
Synonyms
  • 2.7.11.1
  • CTCL tumor antigen se20-9
  • KIAA0204
  • Serine/threonine-protein kinase 2
  • STE20-like kinase
  • STE20-related kinase
  • STE20-related serine/threonine-protein kinase
  • STK2
Gene Name
SLK
Organism
Humans
Amino acid sequence
>lcl|BSEQ0007723|STE20-like serine/threonine-protein kinase
MSFFNFRKIFKLGSEKKKKQYEHVKRDLNPEDFWEIIGELGDGAFGKVYKAQNKETSVLA
AAKVIDTKSEEELEDYMVEIDILASCDHPNIVKLLDAFYYENNLWILIEFCAGGAVDAVM
LELERPLTESQIQVVCKQTLDALNYLHDNKIIHRDLKAGNILFTLDGDIKLADFGVSAKN
TRTIQRRDSFIGTPYWMAPEVVMCETSKDRPYDYKADVWSLGITLIEMAEIEPPHHELNP
MRVLLKIAKSEPPTLAQPSRWSSNFKDFLKKCLEKNVDARWTTSQLLQHPFVTVDSNKPI
RELIAEAKAEVTEEVEDGKEEDEEEETENSLPIPASKRASSDLSIASSEEDKLSQNACIL
ESVSEKTERSNSEDKLNSKILNEKPTTDEPEKAVEDINEHITDAQLEAMTELHDRTAVIK
ENEREKRPKLENLPDTEDQETVDINSVSEGKENNIMITLETNIEHNLKSEEEKDQEKQQM
FENKLIKSEEIKDTILQTVDLVSQETGEKEANIQAVDSEVGLTKEDTQEKLGEDDKTQKD
VISNTSDVIGTCEAADVAQKVDEDSAEDTQSNDGKEVVEVGQKLINKPMVGPEAGGTKEV
PIKEIVEMNEIEEGKNKEQAINSSENIMDINEEPGTTEGEEITESSSTEEMEVRSVVADT
DQKALGSEVQDASKVTTQIDKEKKEIPVSIKKEPEVTVVSQPTEPQPVLIPSININSDSG
ENKEEIGSLSKTETILPPESENPKENDNDSGTGSTADTSSIDLNLSISSFLSKTKDSGSI
SLQETRRQKKTLKKTRKFIVDGVEVSVTTSKIVTDSDSKTEELRFLRRQELRELRFLQKE
EQRAQQQLNSKLQQQREQIFRRFEQEMMSKKRQYDQEIENLEKQQKQTIERLEQEHTNRL
RDEAKRIKGEQEKELSKFQNMLKNRKKEVINEVEKAPKELRKELMKRRKEELAQSQHAQE
QEFVQKQQQELDGSLKKIIQQQKAELANIERECLNNKQQLMRAREAAIWELEERHLQEKH
QLLKQQLKDQYFMQRHQLLKRHEKETEQMQRYNQRLIEELKNRQTQERARLPKIQRSEAK
TRMAMFKKSLRINSTATPDQDRDKIKQFAAQEEKRQKNERMAQHQKHENQMRDLQLQCEA
NVRELHQLQNEKCHLLVEHETQKLKELDEEHSQELKEWREKLRPRKKTLEEEFARKLQEQ
EVFFKMTGESECLNPSTQSRISKFYPIPSLHSTGS
Number of residues
1235
Molecular Weight
142693.96
Theoretical pI
4.8
GO Classification
Functions
ATP binding / identical protein binding / protein homodimerization activity / protein serine/threonine kinase activity
Processes
activation of protein kinase activity / apoptotic process / protein autophosphorylation / regulation of apoptotic process / regulation of mitotic cell cycle / signal transduction by protein phosphorylation / stress-activated protein kinase signaling cascade
Components
cytoplasm / extracellular exosome
General Function
Protein serine/threonine kinase activity
Specific Function
Mediates apoptosis and actin stress fiber dissolution.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm
Gene sequence
>lcl|BSEQ0019517|STE20-like serine/threonine-protein kinase (SLK)
ATGTCCTTCTTCAATTTCCGTAAGATCTTCAAGTTGGGGAGCGAGAAGAAGAAGAAGCAG
TACGAACACGTGAAGAGGGACCTGAACCCCGAAGACTTTTGGGAGATTATAGGAGAACTG
GGCGACGGAGCCTTTGGGAAAGTGTACAAGGCCCAGAATAAAGAGACCAGTGTTTTAGCT
GCTGCAAAAGTGATTGACACTAAATCTGAAGAAGAACTTGAAGATTACATGGTAGAGATT
GACATATTAGCATCTTGTGATCACCCAAATATAGTCAAGCTTCTAGATGCCTTCTATTAT
GAGAACAATCTTTGGATCCTCATTGAATTTTGTGCAGGTGGAGCAGTAGATGCTGTGATG
CTTGAACTTGAGAGACCATTAACTGAGTCCCAAATACAAGTAGTTTGCAAGCAGACTTTA
GATGCATTGAACTACTTACATGATAATAAGATCATCCACAGAGATCTGAAGGCTGGCAAC
ATTCTCTTTACCTTAGATGGAGATATCAAATTGGCGGATTTTGGAGTATCAGCTAAAAAC
ACGAGGACAATTCAAAGAAGAGATTCCTTTATTGGTACACCATATTGGATGGCTCCTGAA
GTAGTCATGTGTGAAACATCTAAGGACAGACCCTATGACTACAAAGCTGATGTTTGGTCC
CTGGGTATCACTTTAATAGAAATGGCTGAGATAGAACCACCTCATCATGAATTAAATCCA
ATGCGAGTGCTGCTAAAAATAGCAAAATCTGAGCCACCTACATTAGCACAGCCATCCAGA
TGGTCTTCAAATTTTAAGGACTTTCTAAAGAAATGCTTAGAAAAGAATGTGGATGCCAGG
TGGACTACATCTCAGCTGCTGCAGCATCCCTTTGTTACTGTTGATTCCAACAAACCCATC
CGAGAATTGATTGCAGAGGCGAAGGCTGAAGTAACAGAAGAAGTTGAAGATGGCAAAGAG
GAAGATGAAGAGGAGGAAACAGAAAATTCTCTGCCAATACCTGCAAGTAAGCGTGCATCT
TCTGACCTTAGTATCGCCAGCTCTGAAGAAGATAAACTTTCACAAAATGCTTGTATTTTG
GAGTCTGTCTCAGAAAAAACAGAACGTAGTAACTCTGAAGATAAACTCAACAGCAAAATT
CTTAATGAAAAACCCACCACTGATGAACCTGAAAAGGCTGTGGAGGATATTAATGAACAT
ATTACCGATGCTCAGTTAGAAGCAATGACTGAACTCCATGACAGAACAGCAGTAATCAAG
GAGAATGAAAGAGAGAAGAGGCCCAAGCTTGAAAATCTGCCTGACACAGAAGACCAAGAA
ACTGTGGACATTAATTCAGTCAGTGAAGGAAAAGAGAATAATATAATGATAACCTTAGAA
ACAAATATTGAACATAATCTAAAATCTGAGGAAGAAAAGGATCAGGAAAAGCAACAGATG
TTTGAAAATAAGCTTATAAAATCTGAAGAAATTAAAGATACTATTTTGCAAACAGTAGAT
TTAGTTTCTCAAGAGACTGGAGAAAAAGAGGCAAATATTCAGGCAGTTGATAGTGAAGTT
GGGCTTACAAAGGAAGACACCCAAGAGAAATTGGGGGAAGACGACAAAACTCAAAAAGAT
GTGATCAGCAATACAAGTGATGTGATAGGAACATGTGAGGCAGCAGATGTGGCTCAGAAA
GTGGATGAAGACAGTGCTGAGGATACGCAGAGTAATGATGGGAAAGAAGTGGTCGAAGTA
GGCCAGAAATTAATTAATAAGCCCATGGTGGGTCCTGAGGCTGGTGGTACTAAGGAAGTT
CCTATTAAAGAAATAGTTGAAATGAATGAAATAGAAGAAGGTAAAAATAAGGAACAAGCA
ATAAACAGTTCAGAGAACATAATGGACATCAATGAGGAACCAGGAACAACTGAAGGTGAA
GAAATCACTGAGTCAAGTAGCACTGAAGAAATGGAGGTCAGAAGTGTGGTGGCTGATACT
GACCAAAAGGCTTTAGGAAGTGAAGTTCAGGATGCTTCTAAAGTCACTACTCAGATAGAT
AAAGAGAAAAAAGAAATTCCAGTGTCAATTAAAAAAGAGCCTGAAGTTACTGTAGTTTCA
CAGCCCACTGAACCTCAGCCTGTTCTAATACCCAGTATTAATATCAACTCTGACAGTGGA
GAAAATAAAGAAGAAATAGGTTCTTTATCAAAAACTGAAACTATTCTGCCACCAGAATCT
GAGAATCCAAAGGAAAATGATAATGATTCAGGCACTGGTTCCACTGCTGATACTAGCAGT
ATTGACTTGAATTTATCCATCTCTAGCTTTCTAAGTAAAACTAAAGACAGTGGATCGATA
TCTTTACAAGAAACAAGAAGACAAAAGAAAACATTGAAGAAAACACGCAAATTTATTGTT
GATGGTGTAGAAGTGAGTGTAACAACATCAAAGATAGTTACAGATAGTGATTCCAAAACT
GAAGAATTGCGGTTTCTTAGACGTCAGGAACTTCGGGAATTAAGATTTCTTCAGAAAGAA
GAGCAAAGAGCCCAACAACAGCTCAATAGCAAACTACAGCAACAACGAGAACAAATTTTC
CGGCGCTTTGAGCAGGAAATGATGAGTAAAAAGCGACAATATGACCAGGAAATTGAGAAT
CTAGAAAAACAGCAGAAACAGACTATCGAACGCCTGGAACAAGAGCACACAAATCGCTTG
CGAGATGAAGCCAAACGCATCAAAGGAGAACAAGAGAAAGAGTTGTCCAAATTTCAGAAT
ATGCTGAAGAACCGAAAGAAGGAGGAACAAGAGTTTGTTCAGAAACAACAGCAAGAATTA
GATGGCTCTCTGAAAAAGATCATCCAGCAGCAGAAGGCAGAGTTAGCTAATATTGAGAGA
GAGTGCCTGAATAACAAGCAACAGCTCATGAGAGCTCGAGAAGCTGCAATTTGGGAGCTC
GAAGAACGACACTTACAAGAAAAACACCAGCTGCTCAAACAGCAGCTTAAAGATCAGTAT
TTCATGCAAAGACATCAGCTACTTAAGCGCCACGAGAAGGAAACAGAGCAAATGCAGCGT
TACAATCAAAGACTTATTGAGGAATTGAAAAACAGACAGACTCAAGAAAGAGCAAGACTG
CCCAAGATTCAGCGCAGTGAAGCCAAGACTCGAATGGCCATGTTTAAGAAGAGTTTGAGA
ATTAACTCAACAGCCACACCAGATCAGGACCGTGATAAAATTAAACAGTTTGCTGCACAA
GAAGAAAAGAGGCAGAAAAATGAGAGAATGGCTCAGCATCAGAAACATGAGAATCAAATG
CGAGATCTTCAGTTGCAGTGTGAAGCCAATGTCCGCGAACTGCATCAGCTGCAGAATGAA
AAATGCCACTTGTTGGTTGAGCATGAGACTCAGAAACTGAAGGAGTTAGATGAGGAACAT
AGCCAAGAATTAAAGGAGTGGAGAGAGAAATTGAGACCTAGGAAAAAGACACTGGAAGAA
GAGTTTGCCAGGAAACTACAGGAACAGGAAGTATTCTTTAAAATGACTGGGGAGTCTGAA
TGCCTTAACCCATCAACACAGAGCCGGATTTCCAAATTTTATCCTATTCCCAGCTTGCAT
TCCACCGGATCATAA
Chromosome Location
10
Locus
10q24.33
External Identifiers
ResourceLink
UniProtKB IDQ9H2G2
UniProtKB Entry NameSLK_HUMAN
GenBank Protein ID1944185
GenBank Gene IDAB002804
HGNC IDHGNC:11088
General References
  1. Yamada E, Tsujikawa K, Itoh S, Kameda Y, Kohama Y, Yamamoto H: Molecular cloning and characterization of a novel human STE20-like kinase, hSLK. Biochim Biophys Acta. 2000 Feb 28;1495(3):250-62. [Article]
  2. Eichmuller S, Usener D, Dummer R, Stein A, Thiel D, Schadendorf D: Serological detection of cutaneous T-cell lymphoma-associated antigens. Proc Natl Acad Sci U S A. 2001 Jan 16;98(2):629-34. Epub 2001 Jan 9. [Article]
  3. Nagase T, Seki N, Ishikawa K, Ohira M, Kawarabayasi Y, Ohara O, Tanaka A, Kotani H, Miyajima N, Nomura N: Prediction of the coding sequences of unidentified human genes. VI. The coding sequences of 80 new genes (KIAA0201-KIAA0280) deduced by analysis of cDNA clones from cell line KG-1 and brain. DNA Res. 1996 Oct 31;3(5):321-9, 341-54. [Article]
  4. Deloukas P, Earthrowl ME, Grafham DV, Rubenfield M, French L, Steward CA, Sims SK, Jones MC, Searle S, Scott C, Howe K, Hunt SE, Andrews TD, Gilbert JG, Swarbreck D, Ashurst JL, Taylor A, Battles J, Bird CP, Ainscough R, Almeida JP, Ashwell RI, Ambrose KD, Babbage AK, Bagguley CL, Bailey J, Banerjee R, Bates K, Beasley H, Bray-Allen S, Brown AJ, Brown JY, Burford DC, Burrill W, Burton J, Cahill P, Camire D, Carter NP, Chapman JC, Clark SY, Clarke G, Clee CM, Clegg S, Corby N, Coulson A, Dhami P, Dutta I, Dunn M, Faulkner L, Frankish A, Frankland JA, Garner P, Garnett J, Gribble S, Griffiths C, Grocock R, Gustafson E, Hammond S, Harley JL, Hart E, Heath PD, Ho TP, Hopkins B, Horne J, Howden PJ, Huckle E, Hynds C, Johnson C, Johnson D, Kana A, Kay M, Kimberley AM, Kershaw JK, Kokkinaki M, Laird GK, Lawlor S, Lee HM, Leongamornlert DA, Laird G, Lloyd C, Lloyd DM, Loveland J, Lovell J, McLaren S, McLay KE, McMurray A, Mashreghi-Mohammadi M, Matthews L, Milne S, Nickerson T, Nguyen M, Overton-Larty E, Palmer SA, Pearce AV, Peck AI, Pelan S, Phillimore B, Porter K, Rice CM, Rogosin A, Ross MT, Sarafidou T, Sehra HK, Shownkeen R, Skuce CD, Smith M, Standring L, Sycamore N, Tester J, Thorpe A, Torcasso W, Tracey A, Tromans A, Tsolas J, Wall M, Walsh J, Wang H, Weinstock K, West AP, Willey DL, Whitehead SL, Wilming L, Wray PW, Young L, Chen Y, Lovering RC, Moschonas NK, Siebert R, Fechtel K, Bentley D, Durbin R, Hubbard T, Doucette-Stamm L, Beck S, Smith DR, Rogers J: The DNA sequence and comparative analysis of human chromosome 10. Nature. 2004 May 27;429(6990):375-81. [Article]
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
  6. Daub H, Olsen JV, Bairlein M, Gnad F, Oppermann FS, Korner R, Greff Z, Keri G, Stemmann O, Mann M: Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle. Mol Cell. 2008 Aug 8;31(3):438-48. doi: 10.1016/j.molcel.2008.07.007. [Article]
  7. Dephoure N, Zhou C, Villen J, Beausoleil SA, Bakalarski CE, Elledge SJ, Gygi SP: A quantitative atlas of mitotic phosphorylation. Proc Natl Acad Sci U S A. 2008 Aug 5;105(31):10762-7. doi: 10.1073/pnas.0805139105. Epub 2008 Jul 31. [Article]
  8. Oppermann FS, Gnad F, Olsen JV, Hornberger R, Greff Z, Keri G, Mann M, Daub H: Large-scale proteomics analysis of the human kinome. Mol Cell Proteomics. 2009 Jul;8(7):1751-64. doi: 10.1074/mcp.M800588-MCP200. Epub 2009 Apr 15. [Article]
  9. Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [Article]
  10. Olsen JV, Vermeulen M, Santamaria A, Kumar C, Miller ML, Jensen LJ, Gnad F, Cox J, Jensen TS, Nigg EA, Brunak S, Mann M: Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis. Sci Signal. 2010 Jan 12;3(104):ra3. doi: 10.1126/scisignal.2000475. [Article]
  11. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [Article]
  12. Rigbolt KT, Prokhorova TA, Akimov V, Henningsen J, Johansen PT, Kratchmarova I, Kassem M, Mann M, Olsen JV, Blagoev B: System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation. Sci Signal. 2011 Mar 15;4(164):rs3. doi: 10.1126/scisignal.2001570. [Article]
  13. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [Article]
  14. Greenman C, Stephens P, Smith R, Dalgliesh GL, Hunter C, Bignell G, Davies H, Teague J, Butler A, Stevens C, Edkins S, O'Meara S, Vastrik I, Schmidt EE, Avis T, Barthorpe S, Bhamra G, Buck G, Choudhury B, Clements J, Cole J, Dicks E, Forbes S, Gray K, Halliday K, Harrison R, Hills K, Hinton J, Jenkinson A, Jones D, Menzies A, Mironenko T, Perry J, Raine K, Richardson D, Shepherd R, Small A, Tofts C, Varian J, Webb T, West S, Widaa S, Yates A, Cahill DP, Louis DN, Goldstraw P, Nicholson AG, Brasseur F, Looijenga L, Weber BL, Chiew YE, DeFazio A, Greaves MF, Green AR, Campbell P, Birney E, Easton DF, Chenevix-Trench G, Tan MH, Khoo SK, Teh BT, Yuen ST, Leung SY, Wooster R, Futreal PA, Stratton MR: Patterns of somatic mutation in human cancer genomes. Nature. 2007 Mar 8;446(7132):153-8. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB07664K-00546experimentalunknownDetails
DB078532-[4-[4-[(5-cyclopropyl-1H-pyrazol-3-yl)amino]quinazolin-2-yl]iminocyclohexa-2,5-dien-1-yl]acetonitrileexperimentalunknownDetails
DB12010Fostamatinibapproved, investigationalunknowninhibitorDetails