Serine/threonine-protein kinase PLK3

Details

Name
Serine/threonine-protein kinase PLK3
Synonyms
  • 2.7.11.21
  • CNK
  • Cytokine-inducible serine/threonine-protein kinase
  • FGF-inducible kinase
  • FNK
  • PLK-3
  • Polo-like kinase 3
  • PRK
  • Proliferation-related kinase
Gene Name
PLK3
Organism
Humans
Amino acid sequence
>lcl|BSEQ0051924|Serine/threonine-protein kinase PLK3
MEPAAGFLSPRPFQRAAAAPAPPAGPGPPPSALRGPELEMLAGLPTSDPGRLITDPRSGR
TYLKGRLLGKGGFARCYEATDTETGSAYAVKVIPQSRVAKPHQREKILNEIELHRDLQHR
HIVRFSHHFEDADNIYIFLELCSRKSLAHIWKARHTLLEPEVRYYLRQILSGLKYLHQRG
ILHRDLKLGNFFITENMELKVGDFGLAARLEPPEQRKKTICGTPNYVAPEVLLRQGHGPE
ADVWSLGCVMYTLLCGSPPFETADLKETYRCIKQVHYTLPASLSLPARQLLAAILRASPR
DRPSIDQILRHDFFTKGYTPDRLPISSCVTVPDLTPPNPARSLFAKVTKSLFGRKKKSKN
HAQERDEVSGLVSGLMRTSVGHQDARPEAPAASGPAPVSLVETAPEDSSPRGTLASSGDG
FEEGLTVATVVESALCALRNCIAFMPPAEQNPAPLAQPEPLVWVSKWVDYSNKFGFGYQL
SSRRVAVLFNDGTHMALSANRKTVHYNPTSTKHFSFSVGAVPRALQPQLGILRYFASYME
QHLMKGGDLPSVEEVEVPAPPLLLQWVKTDQALLMLFSDGTVQVNFYGDHTKLILSGWEP
LLVTFVARNRSACTYLASHLRQLGCSPDLRQRLRYALRLLRDRSPA
Number of residues
646
Molecular Weight
71628.565
Theoretical pI
Not Available
GO Classification
Functions
ATP binding / p53 binding / protein serine/threonine kinase activity
Processes
apoptotic process / cellular response to DNA damage stimulus / cytoplasmic microtubule organization / DNA damage response, signal transduction by p53 class mediator resulting in cell cycle arrest / endomitotic cell cycle / G1/S transition of mitotic cell cycle / G2/M transition of mitotic cell cycle / Golgi disassembly / mitotic cell cycle checkpoint / mitotic G1/S transition checkpoint / negative regulation of apoptotic process / negative regulation of transcription by RNA polymerase II / positive regulation of chaperone-mediated autophagy / positive regulation of intracellular protein transport / positive regulation of proteasomal ubiquitin-dependent protein catabolic process involved in cellular response to hypoxia / protein kinase B signaling / protein phosphorylation / regulation of cell division / regulation of cytokinesis / regulation of signal transduction by p53 class mediator / response to osmotic stress / response to radiation / response to reactive oxygen species
Components
centrosome / cytoplasm / dendrite / Golgi stack / neuronal cell body / nucleolus / nucleoplasm / nucleus
General Function
Serine/threonine-protein kinase involved in cell cycle regulation, response to stress and Golgi disassembly. Polo-like kinases act by binding and phosphorylating proteins are that already phosphorylated on a specific motif recognized by the POLO box domains. Phosphorylates ATF2, BCL2L1, CDC25A, CDC25C, CHEK2, HIF1A, JUN, p53/TP53, p73/TP73, PTEN, TOP2A and VRK1. Involved in cell cycle regulation: required for entry into S phase and cytokinesis. Phosphorylates BCL2L1, leading to regulate the G2 checkpoint and progression to cytokinesis during mitosis. Plays a key role in response to stress: rapidly activated upon stress stimulation, such as ionizing radiation, reactive oxygen species (ROS), hyperosmotic stress, UV irradiation and hypoxia. Involved in DNA damage response and G1/S transition checkpoint by phosphorylating CDC25A, p53/TP53 and p73/TP73. Phosphorylates p53/TP53 in response to reactive oxygen species (ROS), thereby promoting p53/TP53-mediated apoptosis. Phosphorylates CHEK2 in response to DNA damage, promoting the G2/M transition checkpoint. Phosphorylates the transcription factor p73/TP73 in response to DNA damage, leading to inhibit p73/TP73-mediated transcriptional activation and pro-apoptotic functions. Phosphorylates HIF1A and JUN is response to hypoxia. Phosphorylates ATF2 following hyperosmotic stress in corneal epithelium. Also involved in Golgi disassembly during the cell cycle: part of a MEK1/MAP2K1-dependent pathway that induces Golgi fragmentation during mitosis by mediating phosphorylation of VRK1. May participate in endomitotic cell cycle, a form of mitosis in which both karyokinesis and cytokinesis are interrupted and is a hallmark of megakaryocyte differentiation, via its interaction with CIB1.
Specific Function
Atp binding
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm
Gene sequence
>lcl|BSEQ0051925|Serine/threonine-protein kinase PLK3 (PLK3)
ATGGAGCCTGCCGCCGGTTTCCTGTCTCCGCGCCCCTTCCAGCGTGCGGCCGCCGCGCCC
GCTCCCCCGGCCGGGCCCGGGCCGCCTCCGAGTGCCTTGCGCGGACCTGAGCTGGAGATG
CTGGCCGGGCTACCGACGTCAGACCCCGGGCGCCTCATCACGGACCCGCGCAGCGGCCGC
ACCTACCTCAAAGGCCGCTTGTTGGGCAAGGGGGGCTTCGCCCGCTGCTACGAGGCCACT
GACACAGAGACTGGCAGCGCCTACGCTGTCAAAGTCATCCCGCAGAGCCGCGTCGCCAAG
CCGCATCAGCGCGAGAAGATCCTAAATGAGATTGAGCTGCACCGAGACCTGCAGCACCGC
CACATCGTGCGTTTTTCGCACCACTTTGAGGACGCTGACAACATCTACATTTTCTTGGAG
CTCTGCAGCCGAAAGTCCCTGGCCCACATCTGGAAGGCCCGGCACACCCTGTTGGAGCCA
GAAGTGCGCTACTACCTGCGGCAGATCCTTTCTGGCCTCAAGTACTTGCACCAGCGCGGC
ATCTTGCACCGGGACCTCAAGTTGGGAAATTTTTTCATCACTGAGAACATGGAACTGAAG
GTGGGGGATTTTGGGCTGGCAGCCCGGTTGGAGCCTCCGGAGCAGAGGAAGAAGACCATC
TGTGGCACCCCCAACTATGTGGCTCCAGAAGTGCTGCTGAGACAGGGCCACGGCCCTGAG
GCGGATGTATGGTCACTGGGCTGTGTCATGTACACGCTGCTCTGCGGGAGCCCTCCCTTT
GAGACGGCTGACCTGAAGGAGACGTACCGCTGCATCAAGCAGGTTCACTACACGCTGCCT
GCCAGCCTCTCACTGCCTGCCCGGCAGCTCCTGGCCGCCATCCTTCGGGCCTCACCCCGA
GACCGCCCCTCTATTGACCAGATCCTGCGCCATGACTTCTTTACCAAGGGCTACACCCCC
GATCGACTCCCTATCAGCAGCTGCGTGACAGTCCCAGACCTGACACCCCCCAACCCAGCT
AGGAGTCTGTTTGCCAAAGTTACCAAGAGCCTCTTTGGCAGAAAGAAGAAGAGTAAGAAT
CATGCCCAGGAGAGGGATGAGGTCTCCGGTTTGGTGAGCGGCCTCATGCGCACATCCGTT
GGCCATCAGGATGCCAGGCCAGAGGCTCCAGCAGCTTCTGGCCCAGCCCCTGTCAGCCTG
GTAGAGACAGCACCTGAAGACAGCTCACCCCGTGGGACACTGGCAAGCAGTGGAGATGGA
TTTGAAGAAGGTCTGACTGTGGCCACAGTAGTGGAGTCAGCCCTTTGTGCTCTGAGAAAT
TGTATAGCCTTCATGCCCCCAGCGGAACAGAACCCGGCCCCCCTGGCCCAGCCAGAGCCT
CTGGTGTGGGTCAGCAAGTGGGTTGACTACTCCAATAAGTTCGGCTTTGGGTATCAACTG
TCCAGCCGCCGTGTGGCTGTGCTCTTCAACGATGGCACACATATGGCCCTGTCGGCCAAC
AGAAAGACTGTGCACTACAATCCCACCAGCACAAAGCACTTCTCCTTCTCCGTGGGTGCT
GTGCCCCGGGCCCTGCAGCCTCAGCTGGGTATCCTGCGGTACTTCGCCTCCTACATGGAG
CAGCACCTCATGAAGGGTGGAGATCTGCCCAGTGTGGAAGAGGTAGAGGTACCTGCTCCG
CCCTTGCTGCTGCAGTGGGTCAAGACGGATCAGGCTCTCCTCATGCTGTTTAGTGATGGC
ACTGTCCAGGTGAACTTCTACGGGGACCACACCAAGCTGATTCTCAGTGGCTGGGAGCCC
CTCCTTGTGACTTTTGTGGCCCGAAATCGTAGTGCTTGTACTTACCTCGCTTCCCACCTT
CGGCAGCTGGGCTGCTCTCCAGACCTGCGGCAGCGACTCCGCTATGCTCTGCGCCTGCTC
CGGGACCGCAGCCCAGCCTAG
Chromosome Location
1
Locus
1p34.1
External Identifiers
ResourceLink
UniProtKB IDQ9H4B4
UniProtKB Entry NamePLK3_HUMAN
HGNC IDHGNC:2154
General References
  1. Holtrich U, Wolf G, Yuan J, Bereiter-Hahn J, Karn T, Weiler M, Kauselmann G, Rehli M, Andreesen R, Kaufmann M, Kuhl D, Strebhardt K: Adhesion induced expression of the serine/threonine kinase Fnk in human macrophages. Oncogene. 2000 Oct 5;19(42):4832-9. [Article]
  2. Gregory SG, Barlow KF, McLay KE, Kaul R, Swarbreck D, Dunham A, Scott CE, Howe KL, Woodfine K, Spencer CC, Jones MC, Gillson C, Searle S, Zhou Y, Kokocinski F, McDonald L, Evans R, Phillips K, Atkinson A, Cooper R, Jones C, Hall RE, Andrews TD, Lloyd C, Ainscough R, Almeida JP, Ambrose KD, Anderson F, Andrew RW, Ashwell RI, Aubin K, Babbage AK, Bagguley CL, Bailey J, Beasley H, Bethel G, Bird CP, Bray-Allen S, Brown JY, Brown AJ, Buckley D, Burton J, Bye J, Carder C, Chapman JC, Clark SY, Clarke G, Clee C, Cobley V, Collier RE, Corby N, Coville GJ, Davies J, Deadman R, Dunn M, Earthrowl M, Ellington AG, Errington H, Frankish A, Frankland J, French L, Garner P, Garnett J, Gay L, Ghori MR, Gibson R, Gilby LM, Gillett W, Glithero RJ, Grafham DV, Griffiths C, Griffiths-Jones S, Grocock R, Hammond S, Harrison ES, Hart E, Haugen E, Heath PD, Holmes S, Holt K, Howden PJ, Hunt AR, Hunt SE, Hunter G, Isherwood J, James R, Johnson C, Johnson D, Joy A, Kay M, Kershaw JK, Kibukawa M, Kimberley AM, King A, Knights AJ, Lad H, Laird G, Lawlor S, Leongamornlert DA, Lloyd DM, Loveland J, Lovell J, Lush MJ, Lyne R, Martin S, Mashreghi-Mohammadi M, Matthews L, Matthews NS, McLaren S, Milne S, Mistry S, Moore MJ, Nickerson T, O'Dell CN, Oliver K, Palmeiri A, Palmer SA, Parker A, Patel D, Pearce AV, Peck AI, Pelan S, Phelps K, Phillimore BJ, Plumb R, Rajan J, Raymond C, Rouse G, Saenphimmachak C, Sehra HK, Sheridan E, Shownkeen R, Sims S, Skuce CD, Smith M, Steward C, Subramanian S, Sycamore N, Tracey A, Tromans A, Van Helmond Z, Wall M, Wallis JM, White S, Whitehead SL, Wilkinson JE, Willey DL, Williams H, Wilming L, Wray PW, Wu Z, Coulson A, Vaudin M, Sulston JE, Durbin R, Hubbard T, Wooster R, Dunham I, Carter NP, McVean G, Ross MT, Harrow J, Olson MV, Beck S, Rogers J, Bentley DR, Banerjee R, Bryant SP, Burford DC, Burrill WD, Clegg SM, Dhami P, Dovey O, Faulkner LM, Gribble SM, Langford CF, Pandian RD, Porter KM, Prigmore E: The DNA sequence and biological annotation of human chromosome 1. Nature. 2006 May 18;441(7091):315-21. [Article]
  3. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
  4. Li B, Ouyang B, Pan H, Reissmann PT, Slamon DJ, Arceci R, Lu L, Dai W: Prk, a cytokine-inducible human protein serine/threonine kinase whose expression appears to be down-regulated in lung carcinomas. J Biol Chem. 1996 Aug 9;271(32):19402-8. [Article]
  5. Wiest J, Clark AM, Dai W: Intron/exon organization and polymorphisms of the PLK3/PRK gene in human lung carcinoma cell lines. Genes Chromosomes Cancer. 2001 Dec;32(4):384-9. [Article]
  6. Bahassi el M, Conn CW, Myer DL, Hennigan RF, McGowan CH, Sanchez Y, Stambrook PJ: Mammalian Polo-like kinase 3 (Plk3) is a multifunctional protein involved in stress response pathways. Oncogene. 2002 Sep 26;21(43):6633-40. [Article]
  7. Ouyang B, Pan H, Lu L, Li J, Stambrook P, Li B, Dai W: Human Prk is a conserved protein serine/threonine kinase involved in regulating M phase functions. J Biol Chem. 1997 Nov 7;272(45):28646-51. [Article]
  8. Ouyang B, Li W, Pan H, Meadows J, Hoffmann I, Dai W: The physical association and phosphorylation of Cdc25C protein phosphatase by Prk. Oncogene. 1999 Oct 28;18(44):6029-36. [Article]
  9. Conn CW, Hennigan RF, Dai W, Sanchez Y, Stambrook PJ: Incomplete cytokinesis and induction of apoptosis by overexpression of the mammalian polo-like kinase, Plk3. Cancer Res. 2000 Dec 15;60(24):6826-31. [Article]
  10. Xie S, Wang Q, Wu H, Cogswell J, Lu L, Jhanwar-Uniyal M, Dai W: Reactive oxygen species-induced phosphorylation of p53 on serine 20 is mediated in part by polo-like kinase-3. J Biol Chem. 2001 Sep 28;276(39):36194-9. Epub 2001 Jul 10. [Article]
  11. Xie S, Wu H, Wang Q, Cogswell JP, Husain I, Conn C, Stambrook P, Jhanwar-Uniyal M, Dai W: Plk3 functionally links DNA damage to cell cycle arrest and apoptosis at least in part via the p53 pathway. J Biol Chem. 2001 Nov 16;276(46):43305-12. Epub 2001 Sep 10. [Article]
  12. Wang Q, Xie S, Chen J, Fukasawa K, Naik U, Traganos F, Darzynkiewicz Z, Jhanwar-Uniyal M, Dai W: Cell cycle arrest and apoptosis induced by human Polo-like kinase 3 is mediated through perturbation of microtubule integrity. Mol Cell Biol. 2002 May;22(10):3450-9. [Article]
  13. Ruan Q, Wang Q, Xie S, Fang Y, Darzynkiewicz Z, Guan K, Jhanwar-Uniyal M, Dai W: Polo-like kinase 3 is Golgi localized and involved in regulating Golgi fragmentation during the cell cycle. Exp Cell Res. 2004 Mar 10;294(1):51-9. [Article]
  14. Bahassi el M, Hennigan RF, Myer DL, Stambrook PJ: Cdc25C phosphorylation on serine 191 by Plk3 promotes its nuclear translocation. Oncogene. 2004 Apr 8;23(15):2658-63. [Article]
  15. Xie S, Wang Q, Ruan Q, Liu T, Jhanwar-Uniyal M, Guan K, Dai W: MEK1-induced Golgi dynamics during cell cycle progression is partly mediated by Polo-like kinase-3. Oncogene. 2004 May 6;23(21):3822-9. [Article]
  16. Jiang N, Wang X, Jhanwar-Uniyal M, Darzynkiewicz Z, Dai W: Polo box domain of Plk3 functions as a centrosome localization signal, overexpression of which causes mitotic arrest, cytokinesis defects, and apoptosis. J Biol Chem. 2006 Apr 14;281(15):10577-82. Epub 2006 Feb 14. [Article]
  17. Bahassi el M, Myer DL, McKenney RJ, Hennigan RF, Stambrook PJ: Priming phosphorylation of Chk2 by polo-like kinase 3 (Plk3) mediates its full activation by ATM and a downstream checkpoint in response to DNA damage. Mutat Res. 2006 Apr 11;596(1-2):166-76. Epub 2006 Feb 14. [Article]
  18. Wang L, Dai W, Lu L: Stress-induced c-Jun activation mediated by Polo-like kinase 3 in corneal epithelial cells. J Biol Chem. 2007 Nov 2;282(44):32121-7. Epub 2007 Sep 5. [Article]
  19. Zimmerman WC, Erikson RL: Polo-like kinase 3 is required for entry into S phase. Proc Natl Acad Sci U S A. 2007 Feb 6;104(6):1847-52. Epub 2007 Jan 30. [Article]
  20. Iida M, Matsuda M, Komatani H: Plk3 phosphorylates topoisomerase IIalpha at Thr(1342), a site that is not recognized by Plk1. Biochem J. 2008 Apr 1;411(1):27-32. [Article]
  21. Wang L, Gao J, Dai W, Lu L: Activation of Polo-like kinase 3 by hypoxic stresses. J Biol Chem. 2008 Sep 19;283(38):25928-35. doi: 10.1074/jbc.M801326200. Epub 2008 Jul 23. [Article]
  22. Sang M, Ando K, Okoshi R, Koida N, Li Y, Zhu Y, Shimozato O, Geng C, Shan B, Nakagawara A, Ozaki T: Plk3 inhibits pro-apoptotic activity of p73 through physical interaction and phosphorylation. Genes Cells. 2009 Jul;14(7):775-88. doi: 10.1111/j.1365-2443.2009.01309.x. Epub 2009 May 28. [Article]
  23. Lopez-Sanchez I, Sanz-Garcia M, Lazo PA: Plk3 interacts with and specifically phosphorylates VRK1 in Ser342, a downstream target in a pathway that induces Golgi fragmentation. Mol Cell Biol. 2009 Mar;29(5):1189-201. doi: 10.1128/MCB.01341-08. Epub 2008 Dec 22. [Article]
  24. Xu D, Yao Y, Lu L, Costa M, Dai W: Plk3 functions as an essential component of the hypoxia regulatory pathway by direct phosphorylation of HIF-1alpha. J Biol Chem. 2010 Dec 10;285(50):38944-50. doi: 10.1074/jbc.M110.160325. Epub 2010 Oct 1. [Article]
  25. Xu D, Yao Y, Jiang X, Lu L, Dai W: Regulation of PTEN stability and activity by Plk3. J Biol Chem. 2010 Dec 17;285(51):39935-42. doi: 10.1074/jbc.M110.166462. Epub 2010 Oct 12. [Article]
  26. Naik MU, Naik UP: Calcium- and integrin-binding protein 1 regulates microtubule organization and centrosome segregation through polo like kinase 3 during cell cycle progression. Int J Biochem Cell Biol. 2011 Jan;43(1):120-9. doi: 10.1016/j.biocel.2010.10.003. Epub 2010 Oct 15. [Article]
  27. Naik MU, Pham NT, Beebe K, Dai W, Naik UP: Calcium-dependent inhibition of polo-like kinase 3 activity by CIB1 in breast cancer cells. Int J Cancer. 2011 Feb 1;128(3):587-96. doi: 10.1002/ijc.25388. [Article]
  28. Wang L, Payton R, Dai W, Lu L: Hyperosmotic stress-induced ATF-2 activation through Polo-like kinase 3 in human corneal epithelial cells. J Biol Chem. 2011 Jan 21;286(3):1951-8. doi: 10.1074/jbc.M110.166009. Epub 2010 Nov 22. [Article]
  29. Wang J, Beauchemin M, Bertrand R: Bcl-xL phosphorylation at Ser49 by polo kinase 3 during cell cycle progression and checkpoints. Cell Signal. 2011 Dec;23(12):2030-8. doi: 10.1016/j.cellsig.2011.07.017. Epub 2011 Aug 5. [Article]
  30. Myer DL, Robbins SB, Yin M, Boivin GP, Liu Y, Greis KD, Bahassi el M, Stambrook PJ: Absence of polo-like kinase 3 in mice stabilizes Cdc25A after DNA damage but is not sufficient to produce tumors. Mutat Res. 2011 Sep 1;714(1-2):1-10. doi: 10.1016/j.mrfmmm.2011.02.006. Epub 2011 Mar 3. [Article]
  31. Kostyak JC, Naik UP: Calcium- and integrin-binding protein 1 regulates endomitosis and its interaction with Polo-like kinase 3 is enhanced in endomitotic Dami cells. PLoS One. 2011 Jan 14;6(1):e14513. doi: 10.1371/journal.pone.0014513. [Article]
  32. Strebhardt K: Multifaceted polo-like kinases: drug targets and antitargets for cancer therapy. Nat Rev Drug Discov. 2010 Aug;9(8):643-60. doi: 10.1038/nrd3184. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB12010Fostamatinibapproved, investigationalunknowninhibitorDetails