Beta-lactamase
Details
- Name
- Beta-lactamase
- Synonyms
- 3.5.2.6
- beta-lactamase CTX-M-14
- bla-CTX-M-14a
- blaCTX-M
- blaCTX-M-14a
- blaCTX-M-14b
- blaCTX-M-14c
- blaCTX-M-27b
- blatoho-3
- blaUOE-2
- CTX-M-14
- Gene Name
- blaCTX-M-14
- Organism
- Escherichia coli
- Amino acid sequence
>lcl|BSEQ0052132|Beta-lactamase MVTKRVQRMMFAAAACIPLLLGSAPLYAQTSAVQQKLAALEKSSGGRLGVALIDTADNTQ VLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTM TLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDP RDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTVGDKTGS GDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
- Number of residues
- 291
- Molecular Weight
- 30979.09
- Theoretical pI
- Not Available
- GO Classification
- Functionsbeta-lactamase activityProcessesbeta-lactam antibiotic catabolic process / response to antibiotic
- General Function
- Not Available
- Specific Function
- Beta-lactamase activity
- Pfam Domain Function
- Not Available
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID Q9L5C7 UniProtKB Entry Name Q9L5C7_ECOLX - General References
- Chanawong A, M'Zali FH, Heritage J, Xiong JH, Hawkey PM: Three cefotaximases, CTX-M-9, CTX-M-13, and CTX-M-14, among Enterobacteriaceae in the People's Republic of China. Antimicrob Agents Chemother. 2002 Mar;46(3):630-7. [Article]
- Saladin M, Cao VT, Lambert T, Donay JL, Herrmann JL, Ould-Hocine Z, Verdet C, Delisle F, Philippon A, Arlet G: Diversity of CTX-M beta-lactamases and their promoter regions from Enterobacteriaceae isolated in three Parisian hospitals. FEMS Microbiol Lett. 2002 Apr 9;209(2):161-8. [Article]
- Chen Y, Shoichet B, Bonnet R: Structure, function, and inhibition along the reaction coordinate of CTX-M beta-lactamases. J Am Chem Soc. 2005 Apr 20;127(15):5423-34. [Article]
- Ishii Y, Kimura S, Alba J, Shiroto K, Otsuka M, Hashizume N, Tamura K, Yamaguchi K: Extended-spectrum beta-lactamase-producing Shiga toxin gene (Stx1)-positive Escherichia coli O26:H11: a new concern. J Clin Microbiol. 2005 Mar;43(3):1072-5. [Article]
- Chen Y, Delmas J, Sirot J, Shoichet B, Bonnet R: Atomic resolution structures of CTX-M beta-lactamases: extended spectrum activities from increased mobility and decreased stability. J Mol Biol. 2005 Apr 29;348(2):349-62. [Article]
- Eckert C, Gautier V, Arlet G: DNA sequence analysis of the genetic environment of various blaCTX-M genes. J Antimicrob Chemother. 2006 Jan;57(1):14-23. Epub 2005 Nov 16. [Article]
- Bae IK, Lee YN, Lee WG, Lee SH, Jeong SH: Novel complex class 1 integron bearing an ISCR1 element in an Escherichia coli isolate carrying the blaCTX-M-14 gene. Antimicrob Agents Chemother. 2007 Aug;51(8):3017-9. Epub 2007 May 21. [Article]
- Navarro F, Mesa RJ, Miro E, Gomez L, Mirelis B, Coll P: Evidence for convergent evolution of CTX-M-14 ESBL in Escherichia coli and its prevalence. FEMS Microbiol Lett. 2007 Aug;273(1):120-3. Epub 2007 Jun 7. [Article]
- Ho PL, Poon WW, Loke SL, Leung MS, Chow KH, Wong RC, Yip KS, Lai EL, Tsang KW: Community emergence of CTX-M type extended-spectrum beta-lactamases among urinary Escherichia coli from women. J Antimicrob Chemother. 2007 Jul;60(1):140-4. Epub 2007 May 11. [Article]
- Zong Z, Partridge SR, Thomas L, Iredell JR: Dominance of blaCTX-M within an Australian extended-spectrum beta-lactamase gene pool. Antimicrob Agents Chemother. 2008 Nov;52(11):4198-202. doi: 10.1128/AAC.00107-08. Epub 2008 Aug 25. [Article]
- Bae IK, Lee YH, Jeong HJ, Hong SG, Lee SH, Jeong SH: A novel bla(CTX-M-14) gene-harboring complex class 1 integron with an In4-like backbone structure from a clinical isolate of Escherichia coli. Diagn Microbiol Infect Dis. 2008 Nov;62(3):340-2. doi: 10.1016/j.diagmicrobio.2008.06.006. Epub 2008 Aug 13. [Article]
- Valverde A, Canton R, Garcillan-Barcia MP, Novais A, Galan JC, Alvarado A, de la Cruz F, Baquero F, Coque TM: Spread of bla(CTX-M-14) is driven mainly by IncK plasmids disseminated among Escherichia coli phylogroups A, B1, and D in Spain. Antimicrob Agents Chemother. 2009 Dec;53(12):5204-12. doi: 10.1128/AAC.01706-08. Epub 2009 Sep 28. [Article]
- Liu W, Chen L, Li H, Duan H, Zhang Y, Liang X, Li X, Zou M, Xu L, Hawkey PM: Novel CTX-M {beta}-lactamase genotype distribution and spread into multiple species of Enterobacteriaceae in Changsha, Southern China. J Antimicrob Chemother. 2009 May;63(5):895-900. doi: 10.1093/jac/dkp068. Epub 2009 Mar 18. [Article]
- Yuan L, Liu JH, Hu GZ, Pan YS, Liu ZM, Mo J, Wei YJ: Molecular characterization of extended-spectrum beta-lactamase-producing Escherichia coli isolates from chickens in Henan Province, China. J Med Microbiol. 2009 Nov;58(Pt 11):1449-53. doi: 10.1099/jmm.0.012229-0. Epub 2009 Jul 2. [Article]
- Ben Slama K, Ben Sallem R, Jouini A, Rachid S, Moussa L, Saenz Y, Estepa V, Somalo S, Boudabous A, Torres C: Diversity of genetic lineages among CTX-M-15 and CTX-M-14 producing Escherichia coli strains in a Tunisian hospital. Curr Microbiol. 2011 Jun;62(6):1794-801. doi: 10.1007/s00284-011-9930-4. Epub 2011 Apr 10. [Article]
- Ho PL, Lo WU, Wong RC, Yeung MK, Chow KH, Que TL, Tong AH, Bao JY, Lok S, Wong SS: Complete sequencing of the FII plasmid pHK01, encoding CTX-M-14, and molecular analysis of its variants among Escherichia coli from Hong Kong. J Antimicrob Chemother. 2011 Apr;66(4):752-6. doi: 10.1093/jac/dkr010. Epub 2011 Feb 7. [Article]
- Kim J, Bae IK, Jeong SH, Chang CL, Lee CH, Lee K: Characterization of IncF plasmids carrying the blaCTX-M-14 gene in clinical isolates of Escherichia coli from Korea. J Antimicrob Chemother. 2011 Jun;66(6):1263-8. doi: 10.1093/jac/dkr106. Epub 2011 Mar 17. [Article]
- Tacao M, Correia A, Henriques I: Resistance to broad-spectrum antibiotics in aquatic systems: anthropogenic activities modulate the dissemination of bla(CTX-M)-like genes. Appl Environ Microbiol. 2012 Jun;78(12):4134-40. doi: 10.1128/AEM.00359-12. Epub 2012 Apr 6. [Article]
- Kang MS, Kwon YK, Oh JY, Kim MJ, Call DR, An BK, Shin EG, Song EA, Kwon JH: Evidence for recent acquisition and successful transmission of bla(CTX-M-15) in Salmonella enterica in South Korea. Antimicrob Agents Chemother. 2013 May;57(5):2383-7. doi: 10.1128/AAC.01854-12. Epub 2013 Feb 25. [Article]
- Stokes MO, Abuoun M, Umur S, Wu G, Partridge SR, Mevius DJ, Coldham NG, Fielder MD: Complete sequence of pSAM7, an IncX4 plasmid carrying a novel blaCTX-M-14b transposition unit isolated from Escherichia coli and Enterobacter cloacae from cattle. Antimicrob Agents Chemother. 2013 Sep;57(9):4590-4. doi: 10.1128/AAC.01157-13. Epub 2013 Jul 8. [Article]
- Ho PL, Chan J, Lo WU, Law PY, Li Z, Lai EL, Chow KH: Dissemination of plasmid-mediated fosfomycin resistance fosA3 among multidrug-resistant Escherichia coli from livestock and other animals. J Appl Microbiol. 2013 Mar;114(3):695-702. doi: 10.1111/jam.12099. Epub 2012 Dec 27. [Article]
- Sato N, Kawamura K, Nakane K, Wachino J, Arakawa Y: First detection of fosfomycin resistance gene fosA3 in CTX-M-producing Escherichia coli isolates from healthy individuals in Japan. Microb Drug Resist. 2013 Dec;19(6):477-82. doi: 10.1089/mdr.2013.0061. Epub 2013 Aug 3. [Article]
- Hansen KH, Bortolaia V, Damborg P, Guardabassi L: Strain diversity of CTX-M-producing Enterobacteriaceae in individual pigs: insights into the dynamics of shedding during the production cycle. Appl Environ Microbiol. 2014 Nov;80(21):6620-6. doi: 10.1128/AEM.01730-14. Epub 2014 Aug 15. [Article]
- Rao L, Lv L, Zeng Z, Chen S, He D, Chen X, Wu C, Wang Y, Yang T, Wu P, Liu Y, Liu JH: Increasing prevalence of extended-spectrum cephalosporin-resistant Escherichia coli in food animals and the diversity of CTX-M genotypes during 2003-2012. Vet Microbiol. 2014 Aug 27;172(3-4):534-41. doi: 10.1016/j.vetmic.2014.06.013. Epub 2014 Jun 22. [Article]
- Zhang WJ, Wang XM, Dai L, Hua X, Dong Z, Schwarz S, Liu S: Novel conjugative plasmid from Escherichia coli of swine origin that coharbors the multiresistance gene cfr and the extended-spectrum-beta-lactamase gene blaCTX-M-14b. Antimicrob Agents Chemother. 2015 Feb;59(2):1337-40. doi: 10.1128/AAC.04631-14. Epub 2014 Nov 24. [Article]
- Li JJ, Spychala CN, Hu F, Sheng JF, Doi Y: Complete nucleotide sequences of bla(CTX-M)-harboring IncF plasmids from community-associated Escherichia coli strains in the United States. Antimicrob Agents Chemother. 2015;59(6):3002-7. doi: 10.1128/AAC.04772-14. Epub 2015 Mar 9. [Article]
- Lewandowski EM, Skiba J, Torelli NJ, Rajnisz A, Solecka J, Kowalski K, Chen Y: Antibacterial properties and atomic resolution X-ray complex crystal structure of a ruthenocene conjugated beta-lactam antibiotic. Chem Commun (Camb). 2015 Apr 11;51(28):6186-9. doi: 10.1039/c5cc00904a. [Article]
- Wang D, Huang X, Chen J, Mou Y, Li H, Yang L: Characterization of genetic structures of the QepA3 gene in clinical isolates of Enterobacteriaceae. Front Microbiol. 2015 Oct 15;6:1147. doi: 10.3389/fmicb.2015.01147. eCollection 2015. [Article]
- Matsumura Y, Pitout JD, Gomi R, Matsuda T, Noguchi T, Yamamoto M, Peirano G, DeVinney R, Bradford PA, Motyl MR, Tanaka M, Nagao M, Takakura S, Ichiyama S: Global Escherichia coli Sequence Type 131 Clade with blaCTX-M-27 Gene. Emerg Infect Dis. 2016 Nov;22(11):1900-1907. doi: 10.3201/eid2211.160519. [Article]
- Patel MP, Hu L, Stojanoski V, Sankaran B, Prasad BVV, Palzkill T: The Drug-Resistant Variant P167S Expands the Substrate Profile of CTX-M beta-Lactamases for Oxyimino-Cephalosporin Antibiotics by Enlarging the Active Site upon Acylation. Biochemistry. 2017 Jul 11;56(27):3443-3453. doi: 10.1021/acs.biochem.7b00176. Epub 2017 Jun 27. [Article]
- Luo Y, Luo R, Ding H, Ren X, Luo H, Zhang Y, Ye L, Cui S: Characterization of Carbapenem-Resistant Escherichia coli Isolates Through the Whole-Genome Sequencing Analysis. Microb Drug Resist. 2018 Mar;24(2):175-180. doi: 10.1089/mdr.2017.0079. Epub 2017 Jul 7. [Article]
- Pemberton OA, Zhang X, Nichols DA, DeFrees K, Jaishankar P, Bonnet R, Adams J, Shaw LN, Renslo AR, Chen Y: Antibacterial Spectrum of a Tetrazole-Based Reversible Inhibitor of Serine beta-Lactamases. Antimicrob Agents Chemother. 2018 Jul 27;62(8). pii: AAC.02563-17. doi: 10.1128/AAC.02563-17. Print 2018 Aug. [Article]
- Torelli NJ, Akhtar A, DeFrees K, Jaishankar P, Pemberton OA, Zhang X, Johnson C, Renslo AR, Chen Y: Active-Site Druggability of Carbapenemases and Broad-Spectrum Inhibitor Discovery. ACS Infect Dis. 2019 Jun 14;5(6):1013-1021. doi: 10.1021/acsinfecdis.9b00052. Epub 2019 Apr 15. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details DB02772 Sucrose approved, experimental, investigational unknown Details DB04035 Ceftazidime BATSI experimental unknown Details DB09060 Avibactam approved yes inhibitor Details DB12107 Vaborbactam approved, investigational yes inhibitor Details DB12377 Relebactam approved, investigational yes inhibitor Details DB01598 Imipenem approved no substrate Details