Beta-lactamase

Details

Name
Beta-lactamase
Synonyms
  • 3.5.2.6
  • beta-lactamase CTX-M-14
  • bla-CTX-M-14a
  • blaCTX-M
  • blaCTX-M-14a
  • blaCTX-M-14b
  • blaCTX-M-14c
  • blaCTX-M-27b
  • blatoho-3
  • blaUOE-2
  • CTX-M-14
Gene Name
blaCTX-M-14
Organism
Escherichia coli
Amino acid sequence
>lcl|BSEQ0052132|Beta-lactamase
MVTKRVQRMMFAAAACIPLLLGSAPLYAQTSAVQQKLAALEKSSGGRLGVALIDTADNTQ
VLYRGDERFPMCSTSKVMAAAAVLKQSETQKQLLNQPVEIKPADLVNYNPIAEKHVNGTM
TLAELSAAALQYSDNTAMNKLIAQLGGPGGVTAFARAIGDETFRLDRTEPTLNTAIPGDP
RDTTTPRAMAQTLRQLTLGHALGETQRAQLVTWLKGNTTGAASIRAGLPTSWTVGDKTGS
GDYGTTNDIAVIWPQGRAPLVLVTYFTQPQQNAESRRDVLASAARIIAEGL
Number of residues
291
Molecular Weight
30979.09
Theoretical pI
Not Available
GO Classification
Functions
beta-lactamase activity
Processes
beta-lactam antibiotic catabolic process / response to antibiotic
General Function
Not Available
Specific Function
Beta-lactamase activity
Pfam Domain Function
Not Available
Transmembrane Regions
Not Available
Cellular Location
Not Available
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ9L5C7
UniProtKB Entry NameQ9L5C7_ECOLX
General References
  1. Chanawong A, M'Zali FH, Heritage J, Xiong JH, Hawkey PM: Three cefotaximases, CTX-M-9, CTX-M-13, and CTX-M-14, among Enterobacteriaceae in the People's Republic of China. Antimicrob Agents Chemother. 2002 Mar;46(3):630-7. [Article]
  2. Saladin M, Cao VT, Lambert T, Donay JL, Herrmann JL, Ould-Hocine Z, Verdet C, Delisle F, Philippon A, Arlet G: Diversity of CTX-M beta-lactamases and their promoter regions from Enterobacteriaceae isolated in three Parisian hospitals. FEMS Microbiol Lett. 2002 Apr 9;209(2):161-8. [Article]
  3. Chen Y, Shoichet B, Bonnet R: Structure, function, and inhibition along the reaction coordinate of CTX-M beta-lactamases. J Am Chem Soc. 2005 Apr 20;127(15):5423-34. [Article]
  4. Ishii Y, Kimura S, Alba J, Shiroto K, Otsuka M, Hashizume N, Tamura K, Yamaguchi K: Extended-spectrum beta-lactamase-producing Shiga toxin gene (Stx1)-positive Escherichia coli O26:H11: a new concern. J Clin Microbiol. 2005 Mar;43(3):1072-5. [Article]
  5. Chen Y, Delmas J, Sirot J, Shoichet B, Bonnet R: Atomic resolution structures of CTX-M beta-lactamases: extended spectrum activities from increased mobility and decreased stability. J Mol Biol. 2005 Apr 29;348(2):349-62. [Article]
  6. Eckert C, Gautier V, Arlet G: DNA sequence analysis of the genetic environment of various blaCTX-M genes. J Antimicrob Chemother. 2006 Jan;57(1):14-23. Epub 2005 Nov 16. [Article]
  7. Bae IK, Lee YN, Lee WG, Lee SH, Jeong SH: Novel complex class 1 integron bearing an ISCR1 element in an Escherichia coli isolate carrying the blaCTX-M-14 gene. Antimicrob Agents Chemother. 2007 Aug;51(8):3017-9. Epub 2007 May 21. [Article]
  8. Navarro F, Mesa RJ, Miro E, Gomez L, Mirelis B, Coll P: Evidence for convergent evolution of CTX-M-14 ESBL in Escherichia coli and its prevalence. FEMS Microbiol Lett. 2007 Aug;273(1):120-3. Epub 2007 Jun 7. [Article]
  9. Ho PL, Poon WW, Loke SL, Leung MS, Chow KH, Wong RC, Yip KS, Lai EL, Tsang KW: Community emergence of CTX-M type extended-spectrum beta-lactamases among urinary Escherichia coli from women. J Antimicrob Chemother. 2007 Jul;60(1):140-4. Epub 2007 May 11. [Article]
  10. Zong Z, Partridge SR, Thomas L, Iredell JR: Dominance of blaCTX-M within an Australian extended-spectrum beta-lactamase gene pool. Antimicrob Agents Chemother. 2008 Nov;52(11):4198-202. doi: 10.1128/AAC.00107-08. Epub 2008 Aug 25. [Article]
  11. Bae IK, Lee YH, Jeong HJ, Hong SG, Lee SH, Jeong SH: A novel bla(CTX-M-14) gene-harboring complex class 1 integron with an In4-like backbone structure from a clinical isolate of Escherichia coli. Diagn Microbiol Infect Dis. 2008 Nov;62(3):340-2. doi: 10.1016/j.diagmicrobio.2008.06.006. Epub 2008 Aug 13. [Article]
  12. Valverde A, Canton R, Garcillan-Barcia MP, Novais A, Galan JC, Alvarado A, de la Cruz F, Baquero F, Coque TM: Spread of bla(CTX-M-14) is driven mainly by IncK plasmids disseminated among Escherichia coli phylogroups A, B1, and D in Spain. Antimicrob Agents Chemother. 2009 Dec;53(12):5204-12. doi: 10.1128/AAC.01706-08. Epub 2009 Sep 28. [Article]
  13. Liu W, Chen L, Li H, Duan H, Zhang Y, Liang X, Li X, Zou M, Xu L, Hawkey PM: Novel CTX-M {beta}-lactamase genotype distribution and spread into multiple species of Enterobacteriaceae in Changsha, Southern China. J Antimicrob Chemother. 2009 May;63(5):895-900. doi: 10.1093/jac/dkp068. Epub 2009 Mar 18. [Article]
  14. Yuan L, Liu JH, Hu GZ, Pan YS, Liu ZM, Mo J, Wei YJ: Molecular characterization of extended-spectrum beta-lactamase-producing Escherichia coli isolates from chickens in Henan Province, China. J Med Microbiol. 2009 Nov;58(Pt 11):1449-53. doi: 10.1099/jmm.0.012229-0. Epub 2009 Jul 2. [Article]
  15. Ben Slama K, Ben Sallem R, Jouini A, Rachid S, Moussa L, Saenz Y, Estepa V, Somalo S, Boudabous A, Torres C: Diversity of genetic lineages among CTX-M-15 and CTX-M-14 producing Escherichia coli strains in a Tunisian hospital. Curr Microbiol. 2011 Jun;62(6):1794-801. doi: 10.1007/s00284-011-9930-4. Epub 2011 Apr 10. [Article]
  16. Ho PL, Lo WU, Wong RC, Yeung MK, Chow KH, Que TL, Tong AH, Bao JY, Lok S, Wong SS: Complete sequencing of the FII plasmid pHK01, encoding CTX-M-14, and molecular analysis of its variants among Escherichia coli from Hong Kong. J Antimicrob Chemother. 2011 Apr;66(4):752-6. doi: 10.1093/jac/dkr010. Epub 2011 Feb 7. [Article]
  17. Kim J, Bae IK, Jeong SH, Chang CL, Lee CH, Lee K: Characterization of IncF plasmids carrying the blaCTX-M-14 gene in clinical isolates of Escherichia coli from Korea. J Antimicrob Chemother. 2011 Jun;66(6):1263-8. doi: 10.1093/jac/dkr106. Epub 2011 Mar 17. [Article]
  18. Tacao M, Correia A, Henriques I: Resistance to broad-spectrum antibiotics in aquatic systems: anthropogenic activities modulate the dissemination of bla(CTX-M)-like genes. Appl Environ Microbiol. 2012 Jun;78(12):4134-40. doi: 10.1128/AEM.00359-12. Epub 2012 Apr 6. [Article]
  19. Kang MS, Kwon YK, Oh JY, Kim MJ, Call DR, An BK, Shin EG, Song EA, Kwon JH: Evidence for recent acquisition and successful transmission of bla(CTX-M-15) in Salmonella enterica in South Korea. Antimicrob Agents Chemother. 2013 May;57(5):2383-7. doi: 10.1128/AAC.01854-12. Epub 2013 Feb 25. [Article]
  20. Stokes MO, Abuoun M, Umur S, Wu G, Partridge SR, Mevius DJ, Coldham NG, Fielder MD: Complete sequence of pSAM7, an IncX4 plasmid carrying a novel blaCTX-M-14b transposition unit isolated from Escherichia coli and Enterobacter cloacae from cattle. Antimicrob Agents Chemother. 2013 Sep;57(9):4590-4. doi: 10.1128/AAC.01157-13. Epub 2013 Jul 8. [Article]
  21. Ho PL, Chan J, Lo WU, Law PY, Li Z, Lai EL, Chow KH: Dissemination of plasmid-mediated fosfomycin resistance fosA3 among multidrug-resistant Escherichia coli from livestock and other animals. J Appl Microbiol. 2013 Mar;114(3):695-702. doi: 10.1111/jam.12099. Epub 2012 Dec 27. [Article]
  22. Sato N, Kawamura K, Nakane K, Wachino J, Arakawa Y: First detection of fosfomycin resistance gene fosA3 in CTX-M-producing Escherichia coli isolates from healthy individuals in Japan. Microb Drug Resist. 2013 Dec;19(6):477-82. doi: 10.1089/mdr.2013.0061. Epub 2013 Aug 3. [Article]
  23. Hansen KH, Bortolaia V, Damborg P, Guardabassi L: Strain diversity of CTX-M-producing Enterobacteriaceae in individual pigs: insights into the dynamics of shedding during the production cycle. Appl Environ Microbiol. 2014 Nov;80(21):6620-6. doi: 10.1128/AEM.01730-14. Epub 2014 Aug 15. [Article]
  24. Rao L, Lv L, Zeng Z, Chen S, He D, Chen X, Wu C, Wang Y, Yang T, Wu P, Liu Y, Liu JH: Increasing prevalence of extended-spectrum cephalosporin-resistant Escherichia coli in food animals and the diversity of CTX-M genotypes during 2003-2012. Vet Microbiol. 2014 Aug 27;172(3-4):534-41. doi: 10.1016/j.vetmic.2014.06.013. Epub 2014 Jun 22. [Article]
  25. Zhang WJ, Wang XM, Dai L, Hua X, Dong Z, Schwarz S, Liu S: Novel conjugative plasmid from Escherichia coli of swine origin that coharbors the multiresistance gene cfr and the extended-spectrum-beta-lactamase gene blaCTX-M-14b. Antimicrob Agents Chemother. 2015 Feb;59(2):1337-40. doi: 10.1128/AAC.04631-14. Epub 2014 Nov 24. [Article]
  26. Li JJ, Spychala CN, Hu F, Sheng JF, Doi Y: Complete nucleotide sequences of bla(CTX-M)-harboring IncF plasmids from community-associated Escherichia coli strains in the United States. Antimicrob Agents Chemother. 2015;59(6):3002-7. doi: 10.1128/AAC.04772-14. Epub 2015 Mar 9. [Article]
  27. Lewandowski EM, Skiba J, Torelli NJ, Rajnisz A, Solecka J, Kowalski K, Chen Y: Antibacterial properties and atomic resolution X-ray complex crystal structure of a ruthenocene conjugated beta-lactam antibiotic. Chem Commun (Camb). 2015 Apr 11;51(28):6186-9. doi: 10.1039/c5cc00904a. [Article]
  28. Wang D, Huang X, Chen J, Mou Y, Li H, Yang L: Characterization of genetic structures of the QepA3 gene in clinical isolates of Enterobacteriaceae. Front Microbiol. 2015 Oct 15;6:1147. doi: 10.3389/fmicb.2015.01147. eCollection 2015. [Article]
  29. Matsumura Y, Pitout JD, Gomi R, Matsuda T, Noguchi T, Yamamoto M, Peirano G, DeVinney R, Bradford PA, Motyl MR, Tanaka M, Nagao M, Takakura S, Ichiyama S: Global Escherichia coli Sequence Type 131 Clade with blaCTX-M-27 Gene. Emerg Infect Dis. 2016 Nov;22(11):1900-1907. doi: 10.3201/eid2211.160519. [Article]
  30. Patel MP, Hu L, Stojanoski V, Sankaran B, Prasad BVV, Palzkill T: The Drug-Resistant Variant P167S Expands the Substrate Profile of CTX-M beta-Lactamases for Oxyimino-Cephalosporin Antibiotics by Enlarging the Active Site upon Acylation. Biochemistry. 2017 Jul 11;56(27):3443-3453. doi: 10.1021/acs.biochem.7b00176. Epub 2017 Jun 27. [Article]
  31. Luo Y, Luo R, Ding H, Ren X, Luo H, Zhang Y, Ye L, Cui S: Characterization of Carbapenem-Resistant Escherichia coli Isolates Through the Whole-Genome Sequencing Analysis. Microb Drug Resist. 2018 Mar;24(2):175-180. doi: 10.1089/mdr.2017.0079. Epub 2017 Jul 7. [Article]
  32. Pemberton OA, Zhang X, Nichols DA, DeFrees K, Jaishankar P, Bonnet R, Adams J, Shaw LN, Renslo AR, Chen Y: Antibacterial Spectrum of a Tetrazole-Based Reversible Inhibitor of Serine beta-Lactamases. Antimicrob Agents Chemother. 2018 Jul 27;62(8). pii: AAC.02563-17. doi: 10.1128/AAC.02563-17. Print 2018 Aug. [Article]
  33. Torelli NJ, Akhtar A, DeFrees K, Jaishankar P, Pemberton OA, Zhang X, Johnson C, Renslo AR, Chen Y: Active-Site Druggability of Carbapenemases and Broad-Spectrum Inhibitor Discovery. ACS Infect Dis. 2019 Jun 14;5(6):1013-1021. doi: 10.1021/acsinfecdis.9b00052. Epub 2019 Apr 15. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB02772Sucroseapproved, experimental, investigationalunknownDetails
DB04035Ceftazidime BATSIexperimentalunknownDetails
DB09060AvibactamapprovedyesinhibitorDetails
DB12107Vaborbactamapproved, investigationalyesinhibitorDetails
DB12377Relebactamapproved, investigationalyesinhibitorDetails
DB01598ImipenemapprovednosubstrateDetails