Cytochrome P450 26B1

Details

Name
Cytochrome P450 26B1
Synonyms
  • 1.14.13.-
  • CYP26A2
  • Cytochrome P450 26A2
  • Cytochrome P450 retinoic acid-inactivating 2
  • Cytochrome P450RAI-2
  • P450RAI2
  • Retinoic acid-metabolizing cytochrome
Gene Name
CYP26B1
Organism
Humans
Amino acid sequence
>lcl|BSEQ0049801|Cytochrome P450 26B1
MLFEGLDLVSALATLAACLVSVTLLLAVSQQLWQLRWAATRDKSCKLPIPKGSMGFPLIG
ETGHWLLQGSGFQSSRREKYGNVFKTHLLGRPLIRVTGAENVRKILMGEHHLVSTEWPRS
TRMLLGPNTVSNSIGDIHRNKRKVFSKIFSHEALESYLPKIQLVIQDTLRAWSSHPEAIN
VYQEAQKLTFRMAIRVLLGFSIPEEDLGHLFEVYQQFVDNVFSLPVDLPFSGYRRGIQAR
QILQKGLEKAIREKLQCTQGKDYLDALDLLIESSKEHGKEMTMQELKDGTLELIFAAYAT
TASASTSLIMQLLKHPTVLEKLRDELRAHGILHSGGCPCEGTLRLDTLSGLRYLDCVIKE
VMRLFTPISGGYRTVLQTFELDGFQIPKGWSVMYSIRDTHDTAPVFKDVNVFDPDRFSQA
RSEDKDGRFHYLPFGGGVRTCLGKHLAKLFLKVLAVELASTSRFELATRTFPRITLVPVL
HPVDGLSVKFFGLDSNQNEILPETEAMLSATV
Number of residues
512
Molecular Weight
57512.075
Theoretical pI
Not Available
GO Classification
Functions
heme binding / iron ion binding / oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, NAD(P)H as one donor, and incorporation of one atom of oxygen / retinoic acid 4-hydroxylase activity / retinoic acid binding
Processes
bone morphogenesis / cell fate determination / cellular response to retinoic acid / cornification / embryonic limb morphogenesis / establishment of skin barrier / establishment of T cell polarity / inflammatory response / male meiotic nuclear division / negative regulation of retinoic acid receptor signaling pathway / oxidation-reduction process / positive regulation of gene expression / positive regulation of tongue muscle cell differentiation / proximal/distal pattern formation / regulation of T cell differentiation / retinoic acid catabolic process / retinoic acid receptor signaling pathway / spermatogenesis / sterol metabolic process / tongue morphogenesis / vitamin metabolic process / xenobiotic metabolic process
Components
cytoplasm / endoplasmic reticulum membrane / organelle membrane
General Function
Involved in the metabolism of retinoic acid (RA), rendering this classical morphogen inactive through oxidation. Involved in the specific inactivation of all-trans-retinoic acid (all-trans-RA), with a preference for the following substrates: all-trans-RA > 9-cis-RA > 13-cis-RA. Generates several hydroxylated forms of RA, including 4-OH-RA, 4-oxo-RA, and 18-OH-RA. Essential for postnatal survival. Plays a central role in germ cell development: acts by degrading RA in the developing testis, preventing STRA8 expression, thereby leading to delay of meiosis. Required for the maintenance of the undifferentiated state of male germ cells during embryonic development in Sertoli cells, inducing arrest in G0 phase of the cell cycle and preventing meiotic entry. Plays a role in skeletal development, both at the level of patterning and in the ossification of bone and the establishment of some synovial joints.
Specific Function
Heme binding
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Endoplasmic reticulum membrane
Gene sequence
>lcl|BSEQ0049802|Cytochrome P450 26B1 (CYP26B1)
ATGCTCTTTGAGGGCTTGGATCTGGTGTCGGCGCTGGCCACCCTCGCCGCGTGCCTGGTG
TCCGTGACGCTGCTGCTGGCCGTGTCGCAGCAGCTGTGGCAGCTGCGCTGGGCCGCCACT
CGCGACAAGAGCTGCAAGCTGCCCATCCCCAAGGGATCCATGGGCTTCCCGCTCATCGGA
GAGACCGGCCACTGGCTGCTGCAGGGTTCTGGCTTCCAGTCGTCGCGGAGGGAGAAGTAT
GGCAACGTGTTCAAGACGCATTTGTTGGGGCGGCCGCTGATACGCGTGACCGGCGCGGAG
AACGTGCGCAAGATCCTCATGGGCGAGCACCACCTCGTGAGCACCGAGTGGCCTCGCAGC
ACCCGCATGTTGCTGGGCCCCAACACGGTGTCCAATTCCATTGGCGACATCCACCGCAAC
AAGCGCAAGGTCTTCTCCAAGATCTTCAGCCACGAGGCCCTGGAGAGTTACCTGCCCAAG
ATCCAGCTGGTGATCCAGGACACACTGCGCGCCTGGAGCAGCCACCCCGAGGCCATCAAC
GTGTACCAGGAGGCGCAGAAGCTGACCTTCCGCATGGCCATCCGGGTGCTGCTGGGCTTC
AGCATCCCTGAGGAGGACCTTGGGCACCTCTTTGAGGTCTACCAGCAGTTTGTGGACAAT
GTCTTCTCCCTGCCTGTCGACCTGCCCTTCAGTGGCTACCGGCGGGGCATTCAGGCTCGG
CAGATCCTGCAGAAGGGGCTGGAGAAGGCCATCCGGGAGAAGCTGCAGTGCACACAGGGC
AAGGACTACTTGGACGCCCTGGACCTCCTCATTGAGAGCAGCAAGGAGCACGGGAAGGAG
ATGACCATGCAGGAGCTGAAGGACGGGACCCTGGAGCTGATCTTTGCGGCCTATGCCACC
ACGGCCAGCGCCAGCACCTCACTCATCATGCAGCTGCTGAAGCACCCCACTGTGCTGGAG
AAGCTGCGGGATGAGCTGCGGGCTCATGGCATCCTGCACAGTGGCGGCTGCCCCTGCGAG
GGCACACTGCGCCTGGACACGCTCAGTGGGCTGCGCTACCTGGACTGCGTCATCAAGGAG
GTCATGCGCCTGTTCACGCCCATTTCCGGCGGCTACCGCACTGTGCTGCAGACCTTCGAG
CTTGATGGTTTCCAGATCCCCAAAGGCTGGAGTGTCATGTATAGCATCCGGGACACCCAT
GACACAGCGCCCGTGTTCAAAGACGTGAACGTGTTCGACCCCGATCGCTTCAGCCAGGCG
CGGAGCGAGGACAAGGATGGCCGCTTCCATTACCTCCCGTTCGGTGGCGGTGTCCGGACC
TGCCTGGGCAAGCACCTGGCCAAGCTGTTCCTGAAGGTGCTGGCGGTGGAGCTGGCTAGC
ACCAGCCGCTTTGAGCTGGCCACACGGACCTTCCCCCGCATCACCTTGGTCCCCGTCCTG
CACCCCGTGGATGGCCTCAGCGTCAAGTTCTTTGGCCTGGACTCCAACCAGAACGAGATC
CTGCCGGAGACGGAGGCCATGCTGAGCGCCACAGTCTAA
Chromosome Location
2
Locus
2p13.2
External Identifiers
ResourceLink
UniProtKB IDQ9NR63
UniProtKB Entry NameCP26B_HUMAN
HGNC IDHGNC:20581
General References
  1. White JA, Ramshaw H, Taimi M, Stangle W, Zhang A, Everingham S, Creighton S, Tam SP, Jones G, Petkovich M: Identification of the human cytochrome P450, P450RAI-2, which is predominantly expressed in the adult cerebellum and is responsible for all-trans-retinoic acid metabolism. Proc Natl Acad Sci U S A. 2000 Jun 6;97(12):6403-8. [Article]
  2. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [Article]
  3. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [Article]
  4. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
  5. Laue K, Pogoda HM, Daniel PB, van Haeringen A, Alanay Y, von Ameln S, Rachwalski M, Morgan T, Gray MJ, Breuning MH, Sawyer GM, Sutherland-Smith AJ, Nikkels PG, Kubisch C, Bloch W, Wollnik B, Hammerschmidt M, Robertson SP: Craniosynostosis and multiple skeletal anomalies in humans and zebrafish result from a defect in the localized degradation of retinoic acid. Am J Hum Genet. 2011 Nov 11;89(5):595-606. doi: 10.1016/j.ajhg.2011.09.015. Epub 2011 Oct 20. [Article]
  6. Foti RS, Isoherranen N, Zelter A, Dickmann LJ, Buttrick BR, Diaz P, Douguet D: Identification of Tazarotenic Acid as the First Xenobiotic Substrate of Human Retinoic Acid Hydroxylase CYP26A1 and CYP26B1. J Pharmacol Exp Ther. 2016 May;357(2):281-92. doi: 10.1124/jpet.116.232637. Epub 2016 Mar 2. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00755Tretinoinapproved, investigational, nutraceuticalunknownDetails