Cyclic AMP-dependent transcription factor ATF-5

Details

Name
Cyclic AMP-dependent transcription factor ATF-5
Synonyms
  • Activating transcription factor 5
  • ATFX
  • cAMP-dependent transcription factor ATF-5
  • Transcription factor ATFx
Gene Name
ATF5
Organism
Humans
Amino acid sequence
>lcl|BSEQ0013363|Cyclic AMP-dependent transcription factor ATF-5
MSLLATLGLELDRALLPASGLGWLVDYGKLPPAPAPLAPYEVLGGALEGGLPVGGEPLAG
DGFSDWMTERVDFTALLPLEPPLPPGTLPQPSPTPPDLEAMASLLKKELEQMEDFFLDAP
PLPPPSPPPLPPPPLPPAPSLPLSLPSFDLPQPPVLDTLDLLAIYCRNEAGQEEVGMPPL
PPPQQPPPPSPPQPSRLAPYPHPATTRGDRKQKKRDQNKSAALRYRQRKRAEGEALEGEC
QGLEARNRELKERAESVEREIQYVKDLLIEVYKARSQRTRSC
Number of residues
282
Molecular Weight
30673.855
Theoretical pI
Not Available
GO Classification
Functions
chromatin binding / DNA binding transcription factor activity / kinase binding / RNA polymerase II regulatory region sequence-specific DNA binding / sequence-specific DNA binding / transcription corepressor activity / transcription regulatory region DNA binding / transcriptional activator activity, RNA polymerase II transcription regulatory region sequence-specific DNA binding / tubulin binding
Processes
cerebellar granule cell precursor proliferation / circadian rhythm / fat cell differentiation / multicellular organism growth / negative regulation of apoptotic process / negative regulation of cell cycle G2/M phase transition / negative regulation of cell proliferation / negative regulation of transcription, DNA-templated / olfactory bulb interneuron development / positive regulation of transcription from RNA polymerase II promoter / positive regulation of transcription, DNA-templated / post-embryonic development / regulation of centrosome cycle / regulation of transcription from RNA polymerase II promoter / regulation of transcription, DNA-templated
Components
centrosome / cytosol / nucleoplasm / nucleus / transcription factor complex
General Function
Transcription factor that either stimulates or represses gene transcription through binding of different DNA regulatory elements such as cAMP response element (CRE) (consensus: 5'-GTGACGT[AC][AG]-3'), ATF5-specific response element (ARE) (consensus: 5'-C[CT]TCT[CT]CCTT[AT]-3') but also the amino acid response element (AARE), present in many viral and cellular promoters. Critically involved, often in a cell type-dependent manner, in cell survival, proliferation, and differentiation (PubMed:10373550, PubMed:15358120, PubMed:21212266, PubMed:20654631). Its transcriptional activity is enhanced by CCND3 and slightly inhibited by CDK4 (PubMed:15358120). Important regulator of the cerebral cortex formation, functions in cerebral cortical neuroprogenitor cells to maintain proliferation and to block differentiation into neurons. Must be down-regulated in order for such cells to exit the cycle and differentiate (By similarity). Participates in the pathways by which SHH promotes cerebellar granule neuron progenitor cells proliferation (By similarity). Critical for survival of mature olfactory sensory neurons (OSN), directs expression of OSN-specific genes (By similarity). May be involved in osteogenic differentiation (PubMed:22442021). Promotes cell proliferation and survival by inducing the expression of EGR1 sinergistically with ELK1. Once acetylated by EP300, binds to ARE sequences on target genes promoters, such as BCL2 and EGR1 (PubMed:21791614). Plays an anti-apoptotic role through the transcriptional regulation of BCL2, this function seems to be cell type-dependent (By similarity). Cooperates with NR1I3/CAR in the transcriptional activation of CYP2B6 in liver (PubMed:18332083). In hepatic cells, represses CRE-dependent transcription and inhibits proliferation by blocking at G2/M phase (PubMed:22528486, PubMed:18701499). May act as a negative regulator of IL1B transduction pathway in liver (PubMed:24379400). Upon IL1B stimulus, cooperates with NLK to activate the transactivation activity of C/EBP subfamily members (PubMed:25512613). Besides its function of transcription factor, acts as a cofactor of CEBPB to activate CEBPA and promote adipocyte differentiation (PubMed:24216764). Regulates centrosome dynamics in a cell-cycle- and centriole-age-dependent manner. Forms 9-foci symmetrical ring scaffold around the mother centriole to control centrosome function and the interaction between centrioles and pericentriolar material (PubMed:26213385).
Specific Function
Chromatin binding
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Cytoplasm
Gene sequence
>lcl|BSEQ0013364|Cyclic AMP-dependent transcription factor ATF-5 (ATF5)
ATGTCACTCCTGGCGACCCTGGGGCTGGAGCTGGACAGGGCCCTGCTCCCAGCTAGTGGG
CTGGGATGGCTCGTAGACTATGGGAAACTCCCCCCGGCCCCTGCCCCCCTGGCTCCCTAT
GAGGTCCTTGGGGGAGCCCTGGAGGGCGGGCTTCCAGTGGGGGGAGAGCCCCTGGCAGGT
GATGGCTTCTCTGACTGGATGACTGAGCGAGTTGATTTCACAGCTCTCCTCCCTCTGGAG
CCTCCCTTACCCCCCGGCACCCTCCCCCAACCTTCCCCAACCCCACCTGACCTGGAAGCT
ATGGCCTCCCTCCTCAAGAAGGAGCTGGAACAGATGGAAGACTTCTTCCTAGATGCCCCG
CCCCTCCCACCACCCTCCCCGCCGCCACTACCACCACCACCACTACCACCAGCCCCCTCC
CTCCCCCTGTCCCTCCCCTCCTTTGACCTCCCCCAGCCCCCTGTCTTGGATACTCTGGAC
TTGCTGGCCATCTACTGCCGCAACGAGGCCGGGCAGGAGGAAGTGGGGATGCCGCCTCTG
CCCCCGCCACAGCAGCCCCCTCCTCCTTCTCCACCTCAACCTTCTCGCCTGGCCCCCTAC
CCACATCCTGCCACCACCCGAGGGGACCGCAAGCAAAAGAAGAGAGACCAGAACAAGTCG
GCGGCTCTGAGGTACCGCCAGCGGAAGCGGGCAGAGGGTGAGGCCCTGGAGGGCGAGTGC
CAGGGGCTGGAGGCACGGAATCGCGAGCTGAAGGAACGGGCAGAGTCCGTGGAGCGCGAG
ATCCAGTACGTCAAGGACCTGCTCATCGAGGTTTACAAGGCCCGGAGCCAGAGGACCCGT
AGCTGCTAG
Chromosome Location
19
Locus
19q13.33
External Identifiers
ResourceLink
UniProtKB IDQ9Y2D1
UniProtKB Entry NameATF5_HUMAN
HGNC IDHGNC:790
General References
  1. White JH, McIllhinney RA, Wise A, Ciruela F, Chan WY, Emson PC, Billinton A, Marshall FH: The GABAB receptor interacts directly with the related transcription factors CREB2 and ATFx. Proc Natl Acad Sci U S A. 2000 Dec 5;97(25):13967-72. [PubMed:11087824]
  2. Yamada S, Ohira M, Horie H, Ando K, Takayasu H, Suzuki Y, Sugano S, Hirata T, Goto T, Matsunaga T, Hiyama E, Hayashi Y, Ando H, Suita S, Kaneko M, Sasaki F, Hashizume K, Ohnuma N, Nakagawara A: Expression profiling and differential screening between hepatoblastomas and the corresponding normal livers: identification of high expression of the PLK1 oncogene as a poor-prognostic indicator of hepatoblastomas. Oncogene. 2004 Aug 5;23(35):5901-11. [PubMed:15221005]
  3. Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [PubMed:14702039]
  4. Grimwood J, Gordon LA, Olsen A, Terry A, Schmutz J, Lamerdin J, Hellsten U, Goodstein D, Couronne O, Tran-Gyamfi M, Aerts A, Altherr M, Ashworth L, Bajorek E, Black S, Branscomb E, Caenepeel S, Carrano A, Caoile C, Chan YM, Christensen M, Cleland CA, Copeland A, Dalin E, Dehal P, Denys M, Detter JC, Escobar J, Flowers D, Fotopulos D, Garcia C, Georgescu AM, Glavina T, Gomez M, Gonzales E, Groza M, Hammon N, Hawkins T, Haydu L, Ho I, Huang W, Israni S, Jett J, Kadner K, Kimball H, Kobayashi A, Larionov V, Leem SH, Lopez F, Lou Y, Lowry S, Malfatti S, Martinez D, McCready P, Medina C, Morgan J, Nelson K, Nolan M, Ovcharenko I, Pitluck S, Pollard M, Popkie AP, Predki P, Quan G, Ramirez L, Rash S, Retterer J, Rodriguez A, Rogers S, Salamov A, Salazar A, She X, Smith D, Slezak T, Solovyev V, Thayer N, Tice H, Tsai M, Ustaszewska A, Vo N, Wagner M, Wheeler J, Wu K, Xie G, Yang J, Dubchak I, Furey TS, DeJong P, Dickson M, Gordon D, Eichler EE, Pennacchio LA, Richardson P, Stubbs L, Rokhsar DS, Myers RM, Rubin EM, Lucas SM: The DNA sequence and biology of human chromosome 19. Nature. 2004 Apr 1;428(6982):529-35. [PubMed:15057824]
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [PubMed:15489334]
  6. Pati D, Meistrich ML, Plon SE: Human Cdc34 and Rad6B ubiquitin-conjugating enzymes target repressors of cyclic AMP-induced transcription for proteolysis. Mol Cell Biol. 1999 Jul;19(7):5001-13. [PubMed:10373550]
  7. Liu W, Sun M, Jiang J, Shen X, Sun Q, Liu W, Shen H, Gu J: Cyclin D3 interacts with human activating transcription factor 5 and potentiates its transcription activity. Biochem Biophys Res Commun. 2004 Sep 3;321(4):954-60. [PubMed:15358120]
  8. Gho JW, Ip WK, Chan KY, Law PT, Lai PB, Wong N: Re-expression of transcription factor ATF5 in hepatocellular carcinoma induces G2-M arrest. Cancer Res. 2008 Aug 15;68(16):6743-51. doi: 10.1158/0008-5472.CAN-07-6469. [PubMed:18701499]
  9. Pascual M, Gomez-Lechon MJ, Castell JV, Jover R: ATF5 is a highly abundant liver-enriched transcription factor that cooperates with constitutive androstane receptor in the transactivation of CYP2B6: implications in hepatic stress responses. Drug Metab Dispos. 2008 Jun;36(6):1063-72. doi: 10.1124/dmd.107.019380. Epub 2008 Mar 10. [PubMed:18332083]
  10. Wei Y, Jiang J, Liu D, Zhou J, Chen X, Zhang S, Zong H, Yun X, Gu J: Cdc34-mediated degradation of ATF5 is blocked by cisplatin. J Biol Chem. 2008 Jul 4;283(27):18773-81. doi: 10.1074/jbc.M707879200. Epub 2008 May 5. [PubMed:18458088]
  11. Yamazaki T, Ohmi A, Kurumaya H, Kato K, Abe T, Yamamoto H, Nakanishi N, Okuyama R, Umemura M, Kaise T, Watanabe R, Okawa Y, Takahashi S, Takahashi Y: Regulation of the human CHOP gene promoter by the stress response transcription factor ATF5 via the AARE1 site in human hepatoma HepG2 cells. Life Sci. 2010 Aug 28;87(9-10):294-301. doi: 10.1016/j.lfs.2010.07.006. Epub 2010 Jul 21. [PubMed:20654631]
  12. Dluzen D, Li G, Tacelosky D, Moreau M, Liu DX: BCL-2 is a downstream target of ATF5 that mediates the prosurvival function of ATF5 in a cell type-dependent manner. J Biol Chem. 2011 Mar 4;286(9):7705-13. doi: 10.1074/jbc.M110.207639. Epub 2011 Jan 6. [PubMed:21212266]
  13. Liu DX, Qian D, Wang B, Yang JM, Lu Z: p300-Dependent ATF5 acetylation is essential for Egr-1 gene activation and cell proliferation and survival. Mol Cell Biol. 2011 Sep;31(18):3906-16. doi: 10.1128/MCB.05887-11. Epub 2011 Jul 26. [PubMed:21791614]
  14. Liu X, Liu D, Qian D, Dai J, An Y, Jiang S, Stanley B, Yang J, Wang B, Liu X, Liu DX: Nucleophosmin (NPM1/B23) interacts with activating transcription factor 5 (ATF5) protein and promotes proteasome- and caspase-dependent ATF5 degradation in hepatocellular carcinoma cells. J Biol Chem. 2012 Jun 1;287(23):19599-609. doi: 10.1074/jbc.M112.363622. Epub 2012 Apr 23. [PubMed:22528486]
  15. Leong DT, Abraham MC, Gupta A, Lim TC, Chew FT, Hutmacher DW: ATF5, a possible regulator of osteogenic differentiation in human adipose-derived stem cells. J Cell Biochem. 2012 Aug;113(8):2744-53. doi: 10.1002/jcb.24150. [PubMed:22442021]
  16. Abe T, Kojima M, Akanuma S, Iwashita H, Yamazaki T, Okuyama R, Ichikawa K, Umemura M, Nakano H, Takahashi S, Takahashi Y: N-terminal hydrophobic amino acids of activating transcription factor 5 (ATF5) protein confer interleukin 1beta (IL-1beta)-induced stabilization. J Biol Chem. 2014 Feb 14;289(7):3888-900. doi: 10.1074/jbc.M113.491217. Epub 2013 Dec 30. [PubMed:24379400]
  17. Zhao Y, Zhang YD, Zhang YY, Qian SW, Zhang ZC, Li SF, Guo L, Liu Y, Wen B, Lei QY, Tang QQ, Li X: p300-dependent acetylation of activating transcription factor 5 enhances C/EBPbeta transactivation of C/EBPalpha during 3T3-L1 differentiation. Mol Cell Biol. 2014 Feb;34(3):315-24. doi: 10.1128/MCB.00956-13. Epub 2013 Nov 11. [PubMed:24216764]
  18. Madarampalli B, Yuan Y, Liu D, Lengel K, Xu Y, Li G, Yang J, Liu X, Lu Z, Liu DX: ATF5 Connects the Pericentriolar Materials to the Proximal End of the Mother Centriole. Cell. 2015 Jul 30;162(3):580-92. doi: 10.1016/j.cell.2015.06.055. Epub 2015 Jul 23. [PubMed:26213385]
  19. Zhang ZY, Li SZ, Zhang HH, Wu QR, Gong J, Liang T, Gao L, Xing NN, Liu WB, Du RL, Zhang XD: Stabilization of ATF5 by TAK1-Nemo-like kinase critically regulates the interleukin-1beta-stimulated C/EBP signaling pathway. Mol Cell Biol. 2015 Mar;35(5):778-88. doi: 10.1128/MCB.01228-14. Epub 2014 Dec 15. [PubMed:25512613]
  20. Zhou H, Di Palma S, Preisinger C, Peng M, Polat AN, Heck AJ, Mohammed S: Toward a comprehensive characterization of a human cancer cell phosphoproteome. J Proteome Res. 2013 Jan 4;12(1):260-71. doi: 10.1021/pr300630k. Epub 2012 Dec 18. [PubMed:23186163]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB00852PseudoephedrineapprovedunknowninhibitorDetails