Fumarate reductase flavoprotein subunit

Details

Name
Fumarate reductase flavoprotein subunit
Synonyms
  • 1.3.5.4
  • Fe(3+)-induced flavocytochrome C3
  • Ifc3
  • Iron(III)-induced flavocytochrome C3
Gene Name
ifcA
Organism
Shewanella frigidimarina (strain NCIMB 400)
Amino acid sequence
>lcl|BSEQ0012021|Fumarate reductase flavoprotein subunit
MKLKYLVSAMALVVLSSGTAMAKTPDMGSFHADMGSCQSCHAKPIKVTDSETHENAQCKS
CHGEYAELANDKLQFDPHNSHLGDINCTSCHKGHEEPKFYCNECHSFDIKPMPFSDAKKK
KSWDDGWDQDKIQKAIAAGPSETTQVLVVGAGSAGFNASLAAKKAGANVILVDKAPFSGG
NSMISAGGMNAVGTKQQTAHGVEDKVEWFIEDAMKGGRQQNDIKLVTILAEQSADGVQWL
ESLGANLDDLKRSGGARVDRTHRPHGGKSSGPEIIDTLRKAAKEQGIDTRLNSRVVKLVV
NDDHSVVGAVVHGKHTGYYMIGAKSVVLATGGYGMNKEMIAYYRPTMKDMTSSNNITATG
DGVLMAKEIGASMTDIDWVQAHPTVGKDSRILISETVRGVGAVMVNKDGNRFISELTTRD
KASDAILKQPGQFAWIIFDNQLYKKAKMVRGYDHLEMLYKGDTVEQLAKSTGMKVADLAK
TVSDYNGYVASGKDTAFGRADMPLNMTQSPYYAVKVAPGIHHTMGGVAINTTASVLDLQS
KPIDGLFAAGEVTGGVHGYNRLGGNAIADTVVFGRIAGDNAAKHALDK
Number of residues
588
Molecular Weight
62946.005
Theoretical pI
7.69
GO Classification
Functions
metal ion binding / succinate dehydrogenase activity
Components
periplasmic space
General Function
Succinate dehydrogenase activity
Specific Function
Catalyzes unidirectional fumarate reduction using artificial electron donors such as methyl viologen. The physiological reductant is unknown.
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Periplasm
Gene sequence
>lcl|BSEQ0012022|Fumarate reductase flavoprotein subunit (ifcA)
ATGAAACTAAAATATCTGGTATCAGCGATGGCATTGGTTGTGCTTTCCTCTGGTACTGCA
ATGGCTAAAACCCCCGATATGGGGTCATTCCATGCTGACATGGGCAGTTGTCAATCTTGT
CACGCCAAACCTATCAAGGTTACTGATAGCGAAACTCATGAAAATGCTCAGTGTAAATCA
TGCCACGGAGAGTACGCTGAACTGGCTAATGACAAATTACAGTTTGACCCACACAATTCA
CATTTAGGTGACATTAACTGTACTAGTTGCCATAAAGGCCATGAAGAACCAAAATTTTAC
TGTAATGAGTGTCATTCATTTGATATCAAGCCGATGCCATTTTCTGATGCCAAGAAGAAA
AAATCTTGGGACGACGGATGGGATCAAGACAAAATTCAAAAAGCGATTGCTGCAGGCCCA
AGTGAAACAACGCAAGTATTAGTAGTCGGTGCGGGTAGTGCAGGTTTTAACGCATCATTA
GCCGCTAAAAAAGCCGGTGCTAATGTTATTTTGGTGGATAAAGCACCGTTCAGTGGTGGT
AATTCTATGATTTCAGCTGGTGGTATGAATGCTGTTGGAACTAAGCAGCAAACAGCTCAT
GGTGTTGAAGATAAAGTTGAATGGTTTATCGAAGATGCCATGAAAGGCGGCCGTCAACAG
AATGATATAAAACTGGTGACTATTCTTGCTGAACAGTCTGCTGATGGTGTGCAATGGTTA
GAGTCTTTAGGTGCAAACTTAGATGACTTAAAACGCTCAGGTGGTGCTCGTGTCGACCGT
ACTCATCGTCCACATGGAGGTAAAAGCTCTGGGCCAGAAATTATTGATACTTTACGCAAA
GCGGCCAAAGAACAGGGTATTGATACACGACTAAACTCTCGTGTAGTTAAGTTAGTGGTT
AATGACGATCATAGTGTTGTCGGCGCCGTGGTTCATGGTAAACATACTGGCTATTACATG
ATTGGTGCTAAATCTGTTGTGCTAGCAACGGGTGGTTATGGCATGAATAAAGAAATGATT
GCTTATTACCGTCCAACAATGAAAGACATGACCAGTTCGAACAACATTACCGCCACTGGT
GATGGTGTATTGATGGCAAAAGAAATTGGTGCCAGCATGACCGATATCGACTGGGTTCAA
GCTCACCCAACAGTGGGTAAAGACAGCCGTATTCTGATTTCAGAAACCGTCCGTGGTGTG
GGCGCTGTGATGGTAAACAAAGACGGTAATCGCTTTATTAGCGAGTTAACAACTCGTGAC
AAAGCATCTGATGCTATCTTAAAACAACCTGGCCAGTTTGCTTGGATTATTTTTGATAAC
CAGTTATACAAAAAAGCCAAAATGGTACGCGGTTATGACCATTTAGAAATGCTTTACAAA
GGCGATACTGTTGAACAGTTAGCGAAGAGCACCGGTATGAAAGTCGCTGATTTAGCTAAA
ACAGTCTCTGACTACAATGGTTATGTAGCATCTGGTAAAGACACTGCGTTTGGTCGTGCT
GATATGCCATTGAACATGACCCAAAGTCCTTACTATGCCGTTAAAGTTGCTCCTGGTATT
CATCACACTATGGGTGGTGTCGCGATTAACACAACAGCGTCTGTACTTGACCTTCAAAGT
AAGCCAATTGACGGTTTGTTTGCCGCAGGTGAAGTGACTGGTGGTGTTCATGGTTACAAC
CGTTTGGGCGGTAATGCAATAGCAGATACCGTGGTCTTCGGTCGAATTGCAGGAGATAAC
GCAGCCAAGCATGCTCTAGATAAATAG
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDQ9Z4P0
UniProtKB Entry NameFRD2_SHEFN
GenBank Gene IDAJ236923
General References
  1. Dobbin PS, Butt JN, Powell AK, Reid GA, Richardson DJ: Characterization of a flavocytochrome that is induced during the anaerobic respiration of Fe3+ by Shewanella frigidimarina NCIMB400. Biochem J. 1999 Sep 1;342 ( Pt 2):439-48. [PubMed:10455032]
  2. Bamford V, Dobbin PS, Richardson DJ, Hemmings AM: Open conformation of a flavocytochrome c3 fumarate reductase. Nat Struct Biol. 1999 Dec;6(12):1104-7. [PubMed:10581549]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB03147Flavin adenine dinucleotideapprovedunknownDetails