Alpha globin

Details

Name
Alpha globin
Synonyms
Not Available
Gene Name
Not Available
Organism
Humans
Amino acid sequence
>lcl|BSEQ0052575|Alpha globin
MVLSPADKTNVKAAWGKVGAHAGEYGAEALERHFDLSHGSAQVKGHGKKVADALTNAVAH
VDDMPNALSALSDLHAHKLRVDPVNFKLSHCLLVTLAAHLPAEFTPAVHASLDKFLASVS
TVLTSKYR
Number of residues
128
Molecular Weight
13582.405
Theoretical pI
Not Available
GO Classification
Functions
heme binding / metal ion binding / oxygen binding / oxygen carrier activity
Components
hemoglobin complex
General Function
Not Available
Specific Function
Heme binding
Pfam Domain Function
Transmembrane Regions
Not Available
Cellular Location
Not Available
Chromosome Location
Not Available
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDV9H1D9
UniProtKB Entry NameV9H1D9_HUMAN
General References
  1. Proudfoot NJ, Maniatis T: The structure of a human alpha-globin pseudogene and its relationship to alpha-globin gene duplication. Cell. 1980 Sep;21(2):537-44. doi: 10.1016/0092-8674(80)90491-2. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB01436Alfacalcidolapproved, nutraceuticalnobinderDetails