YopE regulator
Details
- Name
- YopE regulator
- Kind
- protein
- Synonyms
- Not Available
- Gene Name
- yerA
- UniProtKB Entry
- P31491Swiss-Prot
- Organism
- Yersinia pestis
- NCBI Taxonomy ID
- 632
- Amino acid sequence
>lcl|BSEQ0016980|YopE regulator MYSFEQAITQLFQQLSLSIPDTIEPVIGVKVGEFACHITEHPVGQILMFTLPSLDNNDEK ETLLSHNIFSQDILKPILSWDEVGGHPVLWNRQPLNSLDNNSLYTQLEMLVQGAERLQTS SLISPPRSFS
- Number of residues
- 130
- Molecular Weight
- 14649.515
- Theoretical pI
- 4.34
- GO Classification
- Processespathogenesis / regulation of protein secretion / regulation of transcription, DNA-templated / transcription, DNA-templatedComponentscytoplasm
- General Function
- Positive regulator of YopE.
- Specific Function
- Not Available
- Pfam Domain Function
- CesT (PF05932)
- Signal Regions
- Not Available
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Gene sequence
>lcl|BSEQ0016981|YopE regulator (yerA) ATGTATTCATTTGAACAAGCTATCACTCAATTATTTCAACAACTTTCGTTGTCTATTCCA GATACTATTGAACCGGTTATCGGTGTCAAAGTTGGGGAATTCGCCTGCCATATAACAGAG CATCCTGTCGGGCAAATATTAATGTTTACCCTACCTTCTCTTGACAATAATGATGAAAAG GAAACCTTACTTAGCCATAATATATTCAGTCAAGATATATTAAAACCCATCTTATCCTGG GACGAGGTTGGGGGGCACCCAGTGTTATGGAATCGACAACCATTGAACAGCCTGGATAAT AACTCACTATATACTCAGCTTGAGATGCTGGTGCAGGGGGCTGAACGGCTACAAACCTCA TCACTAATCTCACCACCACGGTCATTTAGTTGA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P31491 UniProtKB Entry Name YERA_YERPE GenBank Gene ID M34279 PDB ID(s) 1JYA, 1K6Z KEGG ID pg:1149333 NCBI Gene ID 1149333 - General References
- Forsberg A, Wolf-Watz H: Genetic analysis of the yopE region of Yersinia spp.: identification of a novel conserved locus, yerA, regulating yopE expression. J Bacteriol. 1990 Mar;172(3):1547-55. [Article]
- Perry RD, Straley SC, Fetherston JD, Rose DJ, Gregor J, Blattner FR: DNA sequencing and analysis of the low-Ca2+-response plasmid pCD1 of Yersinia pestis KIM5. Infect Immun. 1998 Oct;66(10):4611-23. [Article]
- Hu P, Elliott J, McCready P, Skowronski E, Garnes J, Kobayashi A, Brubaker RR, Garcia E: Structural organization of virulence-associated plasmids of Yersinia pestis. J Bacteriol. 1998 Oct;180(19):5192-202. [Article]
- Parkhill J, Wren BW, Thomson NR, Titball RW, Holden MT, Prentice MB, Sebaihia M, James KD, Churcher C, Mungall KL, Baker S, Basham D, Bentley SD, Brooks K, Cerdeno-Tarraga AM, Chillingworth T, Cronin A, Davies RM, Davis P, Dougan G, Feltwell T, Hamlin N, Holroyd S, Jagels K, Karlyshev AV, Leather S, Moule S, Oyston PC, Quail M, Rutherford K, Simmonds M, Skelton J, Stevens K, Whitehead S, Barrell BG: Genome sequence of Yersinia pestis, the causative agent of plague. Nature. 2001 Oct 4;413(6855):523-7. [Article]
- Song Y, Tong Z, Wang J, Wang L, Guo Z, Han Y, Zhang J, Pei D, Zhou D, Qin H, Pang X, Han Y, Zhai J, Li M, Cui B, Qi Z, Jin L, Dai R, Chen F, Li S, Ye C, Du Z, Lin W, Wang J, Yu J, Yang H, Wang J, Huang P, Yang R: Complete genome sequence of Yersinia pestis strain 91001, an isolate avirulent to humans. DNA Res. 2004 Jun 30;11(3):179-97. [Article]