T-cell surface glycoprotein CD3 epsilon chain
Details
- Name
- T-cell surface glycoprotein CD3 epsilon chain
- Synonyms
- T-cell surface antigen T3/Leu-4 epsilon chain
- T3E
- Gene Name
- CD3E
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0016054|T-cell surface glycoprotein CD3 epsilon chain MQSGTHWRVLGLCLLSVGVWGQDGNEEMGGITQTPYKVSISGTTVILTCPQYPGSEILWQ HNDKNIGGDEDDKNIGSDEDHLSLKEFSELEQSGYYVCYPRGSKPEDANFYLYLRARVCE NCMEMDVMSVATIVIVDICITGGLLLLVYYWSKNRKAKAKPVTRGAGAGGRQRGQNKERP PPVPNPDYEPIRKGQRDLYSGLNQRRI
- Number of residues
- 207
- Molecular Weight
- 23147.09
- Theoretical pI
- 6.75
- GO Classification
- Functionsprotein heterodimerization activity / protein kinase binding / receptor signaling complex scaffold activity / receptor signaling protein activity / SH3 domain binding / T cell receptor binding / transmembrane signaling receptor activityProcessesapoptotic signaling pathway / cell surface receptor signaling pathway / G-protein coupled receptor signaling pathway / intracellular signal transduction / negative regulation of gene expression / negative regulation of smoothened signaling pathway / negative thymic T cell selection / positive regulation of alpha-beta T cell proliferation / positive regulation of calcium-mediated signaling / positive regulation of gene expression / positive regulation of interferon-gamma production / positive regulation of interleukin-2 biosynthetic process / positive regulation of interleukin-4 production / positive regulation of peptidyl-tyrosine phosphorylation / positive regulation of T cell anergy / positive regulation of T cell proliferation / protein complex assembly / regulation of apoptotic process / regulation of immune response / response to nutrient / signal complex assembly / T cell activation / T cell costimulation / T cell receptor signaling pathway / transmembrane receptor protein tyrosine kinase signaling pathwayComponentsalpha-beta T cell receptor complex / cell-cell junction / external side of plasma membrane / immunological synapse / integral component of plasma membrane / intracellular / plasma membrane / T cell receptor complex
- General Function
- Transmembrane signaling receptor activity
- Specific Function
- The CD3 complex mediates signal transduction, resulting in T cell activation and proliferation. Required for normal immune responses (PubMed:15546002, PubMed:8490660).
- Pfam Domain Function
- ITAM (PF02189)
- Transmembrane Regions
- 127-152
- Cellular Location
- Cell membrane
- Gene sequence
>lcl|BSEQ0016055|T-cell surface glycoprotein CD3 epsilon chain (CD3E) ATGCAGTCGGGCACTCACTGGAGAGTTCTGGGCCTCTGCCTCTTATCAGTTGGCGTTTGG GGGCAAGATGGTAATGAAGAAATGGGTGGTATTACACAGACACCATATAAAGTCTCCATC TCTGGAACCACAGTAATATTGACATGCCCTCAGTATCCTGGATCTGAAATACTATGGCAA CACAATGATAAAAACATAGGCGGTGATGAGGATGATAAAAACATAGGCAGTGATGAGGAT CACCTGTCACTGAAGGAATTTTCAGAATTGGAGCAAAGTGGTTATTATGTCTGCTACCCC AGAGGAAGCAAACCAGAAGATGCGAACTTTTATCTCTACCTGAGGGCAAGAGTGTGTGAG AACTGCATGGAGATGGATGTGATGTCGGTGGCCACAATTGTCATAGTGGACATCTGCATC ACTGGGGGCTTGCTGCTGCTGGTTTACTACTGGAGCAAGAATAGAAAGGCCAAGGCCAAG CCTGTGACACGAGGAGCGGGTGCTGGCGGCAGGCAAAGGGGACAAAACAAGGAGAGGCCA CCACCTGTTCCCAACCCAGACTATGAGCCCATCCGGAAAGGCCAGCGGGACCTGTATTCT GGCCTGAATCAGAGACGCATCTGA
- Chromosome Location
- 11
- Locus
- 11q23
- External Identifiers
Resource Link UniProtKB ID P07766 UniProtKB Entry Name CD3E_HUMAN GenBank Protein ID 469945 GenBank Gene ID X03884 GenAtlas ID CD3E HGNC ID HGNC:1674 - General References
- Gold DP, Puck JM, Pettey CL, Cho M, Coligan J, Woody JN, Terhorst C: Isolation of cDNA clones encoding the 20K non-glycosylated polypeptide chain of the human T-cell receptor/T3 complex. Nature. 1986 May 22-28;321(6068):431-4. [Article]
- Clevers HC, Dunlap S, Wileman TE, Terhorst C: Human CD3-epsilon gene contains three miniexons and is transcribed from a non-TATA promoter. Proc Natl Acad Sci U S A. 1988 Nov;85(21):8156-60. [Article]
- Ota T, Suzuki Y, Nishikawa T, Otsuki T, Sugiyama T, Irie R, Wakamatsu A, Hayashi K, Sato H, Nagai K, Kimura K, Makita H, Sekine M, Obayashi M, Nishi T, Shibahara T, Tanaka T, Ishii S, Yamamoto J, Saito K, Kawai Y, Isono Y, Nakamura Y, Nagahari K, Murakami K, Yasuda T, Iwayanagi T, Wagatsuma M, Shiratori A, Sudo H, Hosoiri T, Kaku Y, Kodaira H, Kondo H, Sugawara M, Takahashi M, Kanda K, Yokoi T, Furuya T, Kikkawa E, Omura Y, Abe K, Kamihara K, Katsuta N, Sato K, Tanikawa M, Yamazaki M, Ninomiya K, Ishibashi T, Yamashita H, Murakawa K, Fujimori K, Tanai H, Kimata M, Watanabe M, Hiraoka S, Chiba Y, Ishida S, Ono Y, Takiguchi S, Watanabe S, Yosida M, Hotuta T, Kusano J, Kanehori K, Takahashi-Fujii A, Hara H, Tanase TO, Nomura Y, Togiya S, Komai F, Hara R, Takeuchi K, Arita M, Imose N, Musashino K, Yuuki H, Oshima A, Sasaki N, Aotsuka S, Yoshikawa Y, Matsunawa H, Ichihara T, Shiohata N, Sano S, Moriya S, Momiyama H, Satoh N, Takami S, Terashima Y, Suzuki O, Nakagawa S, Senoh A, Mizoguchi H, Goto Y, Shimizu F, Wakebe H, Hishigaki H, Watanabe T, Sugiyama A, Takemoto M, Kawakami B, Yamazaki M, Watanabe K, Kumagai A, Itakura S, Fukuzumi Y, Fujimori Y, Komiyama M, Tashiro H, Tanigami A, Fujiwara T, Ono T, Yamada K, Fujii Y, Ozaki K, Hirao M, Ohmori Y, Kawabata A, Hikiji T, Kobatake N, Inagaki H, Ikema Y, Okamoto S, Okitani R, Kawakami T, Noguchi S, Itoh T, Shigeta K, Senba T, Matsumura K, Nakajima Y, Mizuno T, Morinaga M, Sasaki M, Togashi T, Oyama M, Hata H, Watanabe M, Komatsu T, Mizushima-Sugano J, Satoh T, Shirai Y, Takahashi Y, Nakagawa K, Okumura K, Nagase T, Nomura N, Kikuchi H, Masuho Y, Yamashita R, Nakai K, Yada T, Nakamura Y, Ohara O, Isogai T, Sugano S: Complete sequencing and characterization of 21,243 full-length human cDNAs. Nat Genet. 2004 Jan;36(1):40-5. Epub 2003 Dec 21. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Soudais C, de Villartay JP, Le Deist F, Fischer A, Lisowska-Grospierre B: Independent mutations of the human CD3-epsilon gene resulting in a T cell receptor/CD3 complex immunodeficiency. Nat Genet. 1993 Jan;3(1):77-81. [Article]
- Salomon AR, Ficarro SB, Brill LM, Brinker A, Phung QT, Ericson C, Sauer K, Brock A, Horn DM, Schultz PG, Peters EC: Profiling of tyrosine phosphorylation pathways in human cells using mass spectrometry. Proc Natl Acad Sci U S A. 2003 Jan 21;100(2):443-8. Epub 2003 Jan 9. [Article]
- Brill LM, Salomon AR, Ficarro SB, Mukherji M, Stettler-Gill M, Peters EC: Robust phosphoproteomic profiling of tyrosine phosphorylation sites from human T cells using immobilized metal affinity chromatography and tandem mass spectrometry. Anal Chem. 2004 May 15;76(10):2763-72. [Article]
- de Saint Basile G, Geissmann F, Flori E, Uring-Lambert B, Soudais C, Cavazzana-Calvo M, Durandy A, Jabado N, Fischer A, Le Deist F: Severe combined immunodeficiency caused by deficiency in either the delta or the epsilon subunit of CD3. J Clin Invest. 2004 Nov;114(10):1512-7. [Article]
- Gimferrer I, Calvo M, Mittelbrunn M, Farnos M, Sarrias MR, Enrich C, Vives J, Sanchez-Madrid F, Lozano F: Relevance of CD6-mediated interactions in T cell activation and proliferation. J Immunol. 2004 Aug 15;173(4):2262-70. [Article]
- Rush J, Moritz A, Lee KA, Guo A, Goss VL, Spek EJ, Zhang H, Zha XM, Polakiewicz RD, Comb MJ: Immunoaffinity profiling of tyrosine phosphorylation in cancer cells. Nat Biotechnol. 2005 Jan;23(1):94-101. Epub 2004 Dec 12. [Article]
- Mayya V, Lundgren DH, Hwang SI, Rezaul K, Wu L, Eng JK, Rodionov V, Han DK: Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions. Sci Signal. 2009 Aug 18;2(84):ra46. doi: 10.1126/scisignal.2000007. [Article]
- Futterer K, Wong J, Grucza RA, Chan AC, Waksman G: Structural basis for Syk tyrosine kinase ubiquity in signal transduction pathways revealed by the crystal structure of its regulatory SH2 domains bound to a dually phosphorylated ITAM peptide. J Mol Biol. 1998 Aug 21;281(3):523-37. [Article]
- Kjer-Nielsen L, Dunstone MA, Kostenko L, Ely LK, Beddoe T, Mifsud NA, Purcell AW, Brooks AG, McCluskey J, Rossjohn J: Crystal structure of the human T cell receptor CD3 epsilon gamma heterodimer complexed to the therapeutic mAb OKT3. Proc Natl Acad Sci U S A. 2004 May 18;101(20):7675-80. Epub 2004 May 10. [Article]
- Arnett KL, Harrison SC, Wiley DC: Crystal structure of a human CD3-epsilon/delta dimer in complex with a UCHT1 single-chain antibody fragment. Proc Natl Acad Sci U S A. 2004 Nov 16;101(46):16268-73. Epub 2004 Nov 8. [Article]
Drug Relations
- Drug Relations
DrugBank ID Name Drug group Pharmacological action? Actions Details DB00075 Muromonab approved, investigational yes binder Details DB06607 Catumaxomab approved, investigational, withdrawn yes agonist Details DB06606 Teplizumab approved, investigational yes antibody Details DB15434 Mosunetuzumab approved, investigational yes binder Details DB16672 Epcoritamab approved, investigational yes binderantibody Details DB16655 Teclistamab approved, investigational yes antibody Details DB16684 Odronextamab investigational yes binder Details DB16371 Glofitamab approved, investigational yes binderantibody Details DB15395 Elranatamab approved, investigational unknown antibody Details DB17256 Tarlatamab approved, investigational yes binderantibody Details DB16678 Talquetamab approved, investigational yes antibody Details