Certolizumab pegol
Identification
- Summary
Certolizumab pegol is a tumor necrosis factor (TNF) blocker used to treat a variety of autoimmune and autoinflammatory conditions like Crohn's disease, rheumatoid arthritis, active psoriatic arthritis, ankylosing spondylitis, axial spondyloarthritis, and plaque psoriasis.
- Brand Names
- Cimzia
- Generic Name
- Certolizumab pegol
- DrugBank Accession Number
- DB08904
- Background
Certolizumab pegol is a pegylated monoclonal antibody against the tumor necrosis factor-alpha (TNF-alpha).1 It is formed with a humanized Fab fragment of 50 kDa, from an IgG 1 isotype, fused to a 40 kDa polyethylene glycol moiety replacing the Fc antibody region. The absence of the Fc region was ideated to prevent complement fixation and antibody-mediated cytotoxicity as well as to markedly increase its half-life.3
Certolizumab does not require glycosylation for active function and hence, its production is significantly more affordable when compared to other existing TNF-alpha therapies as it can be done directly in bacterial hosts such as E. coli.3 It was developed and manufactured by UCB Pharma, first FDA approved in 200813 and updated for a new indication on March 28, 2019.10
- Type
- Biotech
- Groups
- Approved
- Biologic Classification
- Protein Based Therapies
Monoclonal antibody (mAb) / Fusion proteins - Protein Structure
- Protein Chemical Formula
- C2115H3252N556O673S16
- Protein Average Weight
- 91000.0 Da (Pegylated)
- Sequences
>Amino acid sequence of the light chain DIQMTQSPSSLSASVGDRVTITCKASQNVGTNVAWYQQKPGKAPKALIYSASFLYSGVPY RFSGSGSGTDFTLTISSLQPEDFATYYCQQYNIYPLTFGQGTKVEIKRTVAAPSVFIFPP SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT LSKADYEKHKVYACEVTHQGLSSPVTKSFNRGEC
>Amino acid sequence of the heavy chain EVQLVESGGGLVQPGGSLRLSCAASGYVFTDYGMNWVRQAPGKGLEWMGWINTYIGEPIY ADSVKGRFTFSLDTSKSTAYLQMNSLRAEDTAVYYCARGYRSYAMDYWGQGTLVTVSSAS TKGPSVFPLAPSSKSTSGGTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGL YSLSSVVTVPSSSLGTQTYICNVNHKPSNTKVDKKVEPKSCDKTHTCAA
Download FASTA FormatReferences:
- Synonyms
- Certolizumab pegol
- External IDs
- CDP 870
- CDP-870
- CDP870
- PHA-738144
Pharmacology
- Indication
Certolizumab pegol has been approved for several different conditions listed below:
- Symptomatic management of Chron's disease patients and for the maintenance of clinical response in patients with moderate to severe disease with inadequate response to conventional therapy.
- Treatment of adult patients with moderate to severely active rheumatoid arthritis.
- Treatment of adult patients with active psoriatic arthritis.
- Treatment of adult patients with active ankylosing spondylitis.
- Treatment of adult patients with moderate-to-severe plaque psoriasis that are candidates for systemic therapy or phototherapy.Label
- Treatment of adult patients with active non-radiographic axial spondyloarthritis with objective signs of inflammation.10
In Canada, certolizumab pegol is additionally approved in combination with methotrexate for the symptomatic treatment, including major clinical response, and for the reduction of joint damage in adult patients with moderately to severely active rheumatoid arthritis and psoriatic arthritis.11
Inflammation is a biological response against a potential threat. This response can be normal but in certain conditions, the immune system can attack the body's normal cells or tissues which causes an abnormal inflammation.12 TNF-alpha has been identified as a key regulator of the inflammatory response. The signaling cascades of this inflammatory mediator can produce a wide range of reactions including cell death, survival, differentiation, proliferation and migration.7
Reduce drug development failure ratesBuild, train, & validate machine-learning modelswith evidence-based and structured datasets.Build, train, & validate predictive machine-learning models with structured datasets.- Associated Conditions
Indication Type Indication Combined Product Details Approval Level Age Group Patient Characteristics Dose Form Treatment of Moderate-to-severe plaque psoriasis •••••••••••• ••••• ••••••••• ••• •••••••• •••••••• •••••••••• ••• •••••••••••• ••••••••• Symptomatic treatment of Moderately to severely active rheumatoid arthritis •••••••••••• ••••• ••••••••• Used in combination for symptomatic treatment of Moderately to severely active rheumatoid arthritis Regimen in combination with: Methotrexate (DB00563) •••••••••••• ••••• ••••••••• Treatment of Nonradiographic axial spondyloarthritis •••••••••••• ••••• •••••••••• •••••••• •• ••••••••••• •• ••••••• ••••••••• ••••• •• •••••••••••• ••••••••• Treatment of Nonradiographic axial spondyloarthritis •••••••••••• ••••• ••••••••• ••••• •• •••••••••••• ••••••••• - Contraindications & Blackbox Warnings
- Prevent Adverse Drug Events TodayTap into our Clinical API for life-saving information on contraindications & blackbox warnings, population restrictions, harmful risks, & more.Avoid life-threatening adverse drug events with our Clinical API
- Pharmacodynamics
As part of the mechanism of action and nature of the drug, certolizumab does not induce apoptosis in cultured lymphocytes and monocytes. However, as a piece of the inhibition of inflammation, certolizumab pegol inhibits lipopolysaccharide-induced production of IL-1 beta and it induces nonapoptotic cell death via signaling transmembrane TNF-alpha.3
In vitro studies with certolizumab pegol in human tissue did not show any unexpected binding at 3 mcg/ml nor at 10 mcg/ml. Due to the drug class, certolizumab pegol is not expected to present adverse effects on the major vital systems.14
In phase III clinical trials in psoriatic arthritis patients, certolizumab pegol was reported to generate improvements in skin disease, joint involvement, dactylitis, enthesitis and general life quality. The clinical effect of certolizumab was paired to a comparable safety profile to other TNF-alpha inhibitors.3
The clinical effectiveness of certolizumab pegol was mainly studied in six randomized controlled trials that compared its effect versus placebo. In a comparative study, the efficacy for certolizumab pegol registered ranged from 30-65% while in placebo ranged from 4-25%.5 However, in other additional trials, certolizumab was proven to present a similar clinical efficacy to other disease-modifying antirheumatic drugs in patients with inadequate response to TNF inhibitors.2
- Mechanism of action
Certolizumab targets the activation of TNF-alpha with high affinity (KD 90 pM and IC90 0.004 mcg/ml) which inhibits the downstream inflammatory process.1 It acts by binding and neutralizing the soluble and membrane portions of TNF-alpha without inducing complement or antibody-dependent cytotoxicity due to the lack of the Fc region. The inhibition of TNF-alpha is achieved in a dose-dependent manner and it does not present activity against lymphotoxin alpha (TNF-beta).3,14
One additional feature od certolizumab pegol is that, due to the presence of the PEGylation, it is more significantly distributed into inflamed tissues when compared to other TNF-alpha inhibitors such as infliximab and adalimumab.3
Target Actions Organism ATumor necrosis factor neutralizerHumans - Absorption
After subcutaneous administration, the peak plasma concentration is reached between 54 and 171 hours with a bioavailability of 80%.3 Certolizumab presents a linear pharmacokinetic profile with a peak plasma concentration of 43-49 mcg/ml.14
- Volume of distribution
Certolizumab pegol volume of distribution is reported to be in the range of 4-8 L.8 It is known to have a very good distribution in the joints when compared to other TNF-alpha inhibitors.6
- Protein binding
Monoclonal antibodies are usually not required to have protein binding studies.
- Metabolism
The presence of PEG group in certolizumab pegol delays the metabolism and elimination of this drug. However, once under metabolism, the PEG group gets cleaved from the parent compound and the antibody section is thought to be internalized cells and rescued from metabolism by recycling. Later, it is degraded in the reticuloendothelial system to small peptides and amino acids which can be used for de-novo protein synthesis.4 On the other hand, the PEG section is processed normally by the action of the alcohol dehydrogenase to the formation of carboxylic acid.9
- Route of elimination
As certolizumab is a monoclonal antibody, the elimination route is not widely studied. However, it is known that the elimination of the PEG moiety is dependent on the renal function which links it directly with a high portion of renal elimination.3
- Half-life
The circulatory half-life of certolizumab is of 14 days.3
- Clearance
The clearance rate of certolizumab pegol ranged between 9-14 ml/h when administered intravenously. However, when administered subcutaneously, the clearance rate is estimated to range between 14-21 ml/h depending on the patient condition.14
- Adverse Effects
- Improve decision support & research outcomesWith structured adverse effects data, including: blackbox warnings, adverse reactions, warning & precautions, & incidence rates. View sample adverse effects data in our new Data Library!Improve decision support & research outcomes with our structured adverse effects data.
- Toxicity
The oral ld50 observed in mice is determined to be of 300 mg/kg.MSDS To this date, there have not been reports of overdosage, however, in case of accidental overexposure close monitoring is recommended.Label
Certolizumab pegol does not present mutagenic potential nor presents effects in fertility and reproductive performance. On the other hand, carcinogenicity studies have not been performed.Label
- Pathways
- Not Available
- Pharmacogenomic Effects/ADRs
- Not Available
Interactions
- Drug Interactions
- This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
Drug Interaction Integrate drug-drug
interactions in your softwareAbacavir Abacavir may decrease the excretion rate of Certolizumab pegol which could result in a higher serum level. Abatacept The risk or severity of infection can be increased when Certolizumab pegol is combined with Abatacept. Abciximab The risk or severity of adverse effects can be increased when Abciximab is combined with Certolizumab pegol. Abemaciclib The metabolism of Abemaciclib can be increased when combined with Certolizumab pegol. Abrocitinib The metabolism of Abrocitinib can be increased when combined with Certolizumab pegol. - Food Interactions
- Not Available
Products
- Drug product information from 10+ global regionsOur datasets provide approved product information including:dosage, form, labeller, route of administration, and marketing period.Access drug product information from over 10 global regions.
- Brand Name Prescription Products
Name Dosage Strength Route Labeller Marketing Start Marketing End Region Image Cimzia Injection, solution 200 mg Subcutaneous Ucb Pharma 2020-12-16 Not applicable EU Cimzia Injection, solution 200 mg Subcutaneous Ucb Pharma 2016-09-08 Not applicable EU Cimzia Solution 200 mg / mL Subcutaneous Ucb Inc 2017-08-04 Not applicable Canada Cimzia Injection, powder, lyophilized, for solution; Kit 200 mg/1mL Subcutaneous UCB, Inc. 2008-04-20 Not applicable US Cimzia Injection, solution 200 mg Subcutaneous Ucb Pharma 2020-12-16 Not applicable EU
Categories
- ATC Codes
- L04AB05 — Certolizumab pegol
- Drug Categories
- Agents reducing cytokine levels
- Alcohols
- Amino Acids, Peptides, and Proteins
- Anti-Inflammatory Agents
- Antibodies
- Antibodies, Monoclonal
- Antibodies, Monoclonal, Humanized
- Antineoplastic and Immunomodulating Agents
- Antirheumatic Agents
- Biologics for Rheumatoid Arthritis Treatment
- Blood Proteins
- Disease-modifying Antirheumatic Agents
- Drugs that are Mainly Renally Excreted
- Ethylene Glycols
- Globulins
- Glycols
- Immunoglobulin Fab Fragments
- Immunoglobulin Fragments
- Immunoglobulins
- Immunologic Factors
- Immunoproteins
- Immunosuppressive Agents
- Immunotherapy
- Macromolecular Substances
- Pegylated agents
- Peptide Fragments
- Peptides
- Polyethylene Glycols
- Polymers
- Proteins
- Serum Globulins
- Tumor necrosis factor alpha (TNF-alpha) inhibitors
- Tumor Necrosis Factor Blockers
- Tumor Necrosis Factor Receptor Blocking Activity
- Chemical TaxonomyProvided by Classyfire
- Description
- Not Available
- Kingdom
- Organic Compounds
- Super Class
- Organic Acids
- Class
- Carboxylic Acids and Derivatives
- Sub Class
- Amino Acids, Peptides, and Analogues
- Direct Parent
- Peptides
- Alternative Parents
- Not Available
- Substituents
- Not Available
- Molecular Framework
- Not Available
- External Descriptors
- Not Available
- Affected organisms
- Humans
Chemical Identifiers
- UNII
- UMD07X179E
- CAS number
- 428863-50-7
References
- General References
- Corbett M, Chehadah F, Biswas M, Moe-Byrne T, Palmer S, Soares M, Walton M, Harden M, Ho P, Woolacott N, Bojke L: Certolizumab pegol and secukinumab for treating active psoriatic arthritis following inadequate response to disease-modifying antirheumatic drugs: a systematic review and economic evaluation. Health Technol Assess. 2017 Oct;21(56):1-326. doi: 10.3310/hta21560. [Article]
- Bermejo I, Stevenson M, Archer R, Stevens JW, Goka E, Clowes M, Scott DL, Young A: Certolizumab Pegol for Treating Rheumatoid Arthritis Following Inadequate Response to a TNF-alpha Inhibitor: An Evidence Review Group Perspective of a NICE Single Technology Appraisal. Pharmacoeconomics. 2017 Nov;35(11):1141-1151. doi: 10.1007/s40273-017-0521-5. [Article]
- Acosta-Felquer ML, Rosa J, Soriano ER: An evidence-based review of certolizumab pegol in the treatment of active psoriatic arthritis: place in therapy. Open Access Rheumatol. 2016 Mar 30;8:37-44. doi: 10.2147/OARRR.S56837. eCollection 2016. [Article]
- Tabrizi MA, Tseng CM, Roskos LK: Elimination mechanisms of therapeutic monoclonal antibodies. Drug Discov Today. 2006 Jan;11(1-2):81-8. doi: 10.1016/S1359-6446(05)03638-X. [Article]
- D'Angelo S, Tramontano G, Gilio M, Leccese P, Olivieri I: Review of the treatment of psoriatic arthritis with biological agents: choice of drug for initial therapy and switch therapy for non-responders. Open Access Rheumatol. 2017 Mar 2;9:21-28. doi: 10.2147/OARRR.S56073. eCollection 2017. [Article]
- Lee JU, Shin W, Son JY, Yoo KY, Heo YS: Molecular Basis for the Neutralization of Tumor Necrosis Factor alpha by Certolizumab Pegol in the Treatment of Inflammatory Autoimmune Diseases. Int J Mol Sci. 2017 Jan 23;18(1). pii: ijms18010228. doi: 10.3390/ijms18010228. [Article]
- Bradley JR: TNF-mediated inflammatory disease. J Pathol. 2008 Jan;214(2):149-60. doi: 10.1002/path.2287. [Article]
- Vande Casteele N, Mould DR, Coarse J, Hasan I, Gils A, Feagan B, Sandborn WJ: Accounting for Pharmacokinetic Variability of Certolizumab Pegol in Patients with Crohn's Disease. Clin Pharmacokinet. 2017 Dec;56(12):1513-1523. doi: 10.1007/s40262-017-0535-3. [Article]
- Webster R, Didier E, Harris P, Siegel N, Stadler J, Tilbury L, Smith D: PEGylated proteins: evaluation of their safety in the absence of definitive metabolism studies. Drug Metab Dispos. 2007 Jan;35(1):9-16. doi: 10.1124/dmd.106.012419. Epub 2006 Oct 4. [Article]
- FDA news [Link]
- Pubmed books [Link]
- Nature [Link]
- FDA Approved Drug Products: CIMZIA (certolizumab pegol) injection for subcutaneous use (December 2022) [Link]
- CIMZIA (Certolizumab) Australian Report [File]
- External Links
- KEGG Drug
- D03441
- PubChem Substance
- 347910385
- 709271
- ChEMBL
- CHEMBL1201831
- PharmGKB
- PA165107055
- RxList
- RxList Drug Page
- Drugs.com
- Drugs.com Drug Page
- Wikipedia
- Certolizumab_pegol
- FDA label
- Download (1.71 MB)
- MSDS
- Download (479 KB)
Clinical Trials
- Clinical Trials
Phase Status Purpose Conditions Count 4 Active Not Recruiting Treatment Axial Spondyloarthritis (AxSpA) 1 4 Active Not Recruiting Treatment Rheumatoid Arthritis 2 4 Completed Basic Science Rheumatoid Arthritis 1 4 Completed Treatment Anterior Uveitis (AU) / Axial Spondyloarthritis (AxSpA) 1 4 Completed Treatment Rheumatoid Arthritis 7
Pharmacoeconomics
- Manufacturers
- Not Available
- Packagers
- Not Available
- Dosage Forms
Form Route Strength Injection, powder, lyophilized, for solution; kit Subcutaneous 200 mg/1mL Injection, solution Parenteral; Subcutaneous 200 MG Injection, solution Subcutaneous 200 MG Injection, solution Subcutaneous 200 mg/1mL Solution Parenteral 200.00 mg Solution Subcutaneous 200 mg / mL Injection, solution Parenteral 200 MG Injection, solution Subcutaneous 200 mg/ml Solution Subcutaneous 200 mg - Prices
- Not Available
- Patents
Patent Number Pediatric Extension Approved Expires (estimated) Region CA2380298 No 2010-09-28 2021-06-05 Canada
Properties
- State
- Solid
- Experimental Properties
Property Value Source melting point (°C) 61ºC Vermeer, A.W.P. & Norde, W., Biophys. J. 78:394-404 (2000) boiling point (°C) Fab domain denaturates at 60 ºC Arnoldus W. et al. (2000). Biophysical Journal. Vol 78. 394-404 water solubility Soluble Pasut G. 2014. BioDrugs. isoelectric point 6.6 - 7.2 Jin, et al. Electrophoresis. Sep;23(19):3385-91. (2002).
Targets
- Kind
- Protein
- Organism
- Humans
- Pharmacological action
- Yes
- Actions
- Neutralizer
- General Function
- Tumor necrosis factor receptor binding
- Specific Function
- Cytokine that binds to TNFRSF1A/TNFR1 and TNFRSF1B/TNFBR. It is mainly secreted by macrophages and can induce cell death of certain tumor cell lines. It is potent pyrogen causing fever by direct ac...
- Gene Name
- TNF
- Uniprot ID
- P01375
- Uniprot Name
- Tumor necrosis factor
- Molecular Weight
- 25644.15 Da
References
- Chimenti MS, Saraceno R, Chiricozzi A, Giunta A, Chimenti S, Perricone R: Profile of certolizumab and its potential in the treatment of psoriatic arthritis. Drug Des Devel Ther. 2013 Apr 15;7:339-48. doi: 10.2147/DDDT.S31658. Print 2013. [Article]
- Corbett M, Chehadah F, Biswas M, Moe-Byrne T, Palmer S, Soares M, Walton M, Harden M, Ho P, Woolacott N, Bojke L: Certolizumab pegol and secukinumab for treating active psoriatic arthritis following inadequate response to disease-modifying antirheumatic drugs: a systematic review and economic evaluation. Health Technol Assess. 2017 Oct;21(56):1-326. doi: 10.3310/hta21560. [Article]
Enzymes
- Kind
- Protein
- Organism
- Humans
- Pharmacological action
- No
- Actions
- Substrate
- General Function
- L-glucuronate reductase activity
- Specific Function
- Catalyzes the NADPH-dependent reduction of a variety of aromatic and aliphatic aldehydes to their corresponding alcohols. Catalyzes the reduction of mevaldate to mevalonic acid and of glyceraldehyd...
- Gene Name
- AKR1A1
- Uniprot ID
- P14550
- Uniprot Name
- Alcohol dehydrogenase [NADP(+)]
- Molecular Weight
- 36572.71 Da
References
- Webster R, Didier E, Harris P, Siegel N, Stadler J, Tilbury L, Smith D: PEGylated proteins: evaluation of their safety in the absence of definitive metabolism studies. Drug Metab Dispos. 2007 Jan;35(1):9-16. doi: 10.1124/dmd.106.012419. Epub 2006 Oct 4. [Article]
Drug created at June 11, 2013 06:11 / Updated at February 04, 2023 17:06