30S ribosomal protein S9
Details
- Name
- 30S ribosomal protein S9
- Kind
- protein
- Synonyms
- Not Available
- Gene Name
- rpsI
- UniProtKB Entry
- P0A7X3Swiss-Prot
- Organism
- Escherichia coli (strain K12)
- NCBI Taxonomy ID
- 83333
- Amino acid sequence
>lcl|BSEQ0009951|30S ribosomal protein S9 MAENQYYGTGRRKSSAARVFIKPGNGKIVINQRSLEQYFGRETARMVVRQPLELVDMVEK LDLYITVKGGGISGQAGAIRHGITRALMEYDESLRSELRKAGFVTRDARQVERKKVGLRK ARRRPQFSKR
- Number of residues
- 130
- Molecular Weight
- 14856.105
- Theoretical pI
- 11.52
- GO Classification
- Functionsstructural constituent of ribosome / tRNA bindingProcessestranslationComponentscytosol / cytosolic small ribosomal subunit
- General Function
- The C-terminal tail plays a role in the affinity of the 30S P site for different tRNAs. Mutations that decrease this affinity are suppressed in the 70S ribosome.
- Specific Function
- RNA binding
- Pfam Domain Function
- Ribosomal_S9 (PF00380)
- Signal Regions
- Not Available
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Gene sequence
>lcl|BSEQ0009952|30S ribosomal protein S9 (rpsI) ATGGCTGAAAATCAATACTACGGCACTGGTCGCCGCAAAAGTTCCGCAGCTCGCGTTTTC ATCAAACCGGGCAACGGTAAAATCGTAATCAACCAACGTTCTCTGGAACAGTACTTCGGT CGTGAAACTGCCCGCATGGTAGTTCGTCAGCCGCTGGAACTGGTCGACATGGTTGAGAAA CTGGACCTGTACATCACCGTTAAAGGTGGTGGTATCTCTGGTCAGGCTGGTGCGATCCGT CACGGTATCACCCGCGCTCTGATGGAATACGACGAGTCCCTGCGTTCTGAACTGCGTAAA GCTGGCTTCGTTACTCGTGACGCTCGTCAGGTTGAACGTAAGAAAGTCGGTCTGCGTAAA GCACGTCGTCGTCCGCAGTTCTCCAAACGTTAA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P0A7X3 UniProtKB Entry Name RS9_ECOLI GenBank Protein ID 535073 GenBank Gene ID X02130 PDB ID(s) 1M5G, 2YKR, 3J9Y, 3J9Z, 3JA1, 4A2I, 4ADV, 4U1U, 4U1V, 4U20, 4U24, 4U25, 4U26, 4U27, 4V47, 4V48, 4V4H, 4V4Q, 4V4V, 4V4W, 4V50, 4V52, 4V53, 4V54, 4V55, 4V56, 4V57, 4V5B, 4V5H, 4V5Y, 4V64, 4V65, 4V66, 4V69, 4V6C, 4V6D, 4V6E, 4V6K, 4V6L, 4V6M, 4V6N, 4V6O, 4V6P, 4V6Q, 4V6R, 4V6S, 4V6T, 4V6V, 4V6Y, 4V6Z, 4V70, 4V71, 4V72, 4V73, 4V74, 4V75, 4V76, 4V77, 4V78, 4V79, 4V7A, 4V7B, 4V7C, 4V7D, 4V7I, 4V7S, 4V7T, 4V7U, 4V7V, 4V85, 4V89, 4V9C, 4V9D, 4V9O, 4V9P, 4WF1, 4WOI, 4WWW, 4YBB, 5AFI KEGG ID ecj:JW3199 NCBI Gene ID 5550578 - General References
- Isono S, Thamm S, Kitakawa M, Isono K: Cloning and nucleotide sequencing of the genes for ribosomal proteins S9 (rpsI) and L13 (rplM) of Escherichia coli. Mol Gen Genet. 1985;198(2):279-82. [Article]
- Blattner FR, Plunkett G 3rd, Bloch CA, Perna NT, Burland V, Riley M, Collado-Vides J, Glasner JD, Rode CK, Mayhew GF, Gregor J, Davis NW, Kirkpatrick HA, Goeden MA, Rose DJ, Mau B, Shao Y: The complete genome sequence of Escherichia coli K-12. Science. 1997 Sep 5;277(5331):1453-62. [Article]
- Hayashi K, Morooka N, Yamamoto Y, Fujita K, Isono K, Choi S, Ohtsubo E, Baba T, Wanner BL, Mori H, Horiuchi T: Highly accurate genome sequences of Escherichia coli K-12 strains MG1655 and W3110. Mol Syst Biol. 2006;2:2006.0007. Epub 2006 Feb 21. [Article]
- Chen R, Wittmann-Liebold B: The primary structure of protein S9 from the 30S subunit of Escherichia coli ribosomes. FEBS Lett. 1975 Mar 15;52(1):139-40. [Article]
- Urlaub H, Kruft V, Bischof O, Muller EC, Wittmann-Liebold B: Protein-rRNA binding features and their structural and functional implications in ribosomes as determined by cross-linking studies. EMBO J. 1995 Sep 15;14(18):4578-88. [Article]
- Marsh RC, Parmeggiani A: Requirement of proteins S5 and S9 from 30S subunits for the ribosome-dependent GTPase activity of elongation factor G. Proc Natl Acad Sci U S A. 1973 Jan;70(1):151-5. [Article]
- Osswald M, Doring T, Brimacombe R: The ribosomal neighbourhood of the central fold of tRNA: cross-links from position 47 of tRNA located at the A, P or E site. Nucleic Acids Res. 1995 Nov 25;23(22):4635-41. [Article]
- VanBogelen RA, Abshire KZ, Moldover B, Olson ER, Neidhardt FC: Escherichia coli proteome analysis using the gene-protein database. Electrophoresis. 1997 Aug;18(8):1243-51. [Article]
- Hoang L, Fredrick K, Noller HF: Creating ribosomes with an all-RNA 30S subunit P site. Proc Natl Acad Sci U S A. 2004 Aug 24;101(34):12439-43. Epub 2004 Aug 12. [Article]
- Arnold RJ, Reilly JP: Observation of Escherichia coli ribosomal proteins and their posttranslational modifications by mass spectrometry. Anal Biochem. 1999 Apr 10;269(1):105-12. [Article]
- Tung CS, Joseph S, Sanbonmatsu KY: All-atom homology model of the Escherichia coli 30S ribosomal subunit. Nat Struct Biol. 2002 Oct;9(10):750-5. [Article]
- Gao H, Sengupta J, Valle M, Korostelev A, Eswar N, Stagg SM, Van Roey P, Agrawal RK, Harvey SC, Sali A, Chapman MS, Frank J: Study of the structural dynamics of the E coli 70S ribosome using real-space refinement. Cell. 2003 Jun 13;113(6):789-801. [Article]
- Schuwirth BS, Borovinskaya MA, Hau CW, Zhang W, Vila-Sanjurjo A, Holton JM, Cate JH: Structures of the bacterial ribosome at 3.5 A resolution. Science. 2005 Nov 4;310(5749):827-34. [Article]
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details Clomocycline experimental unknown target inhibitor Details Tigecycline approved yes target binder Details Oxytetracycline approved, investigational, vet_approved yes target inhibitor Details Minocycline approved, investigational yes target inhibitor Details Rolitetracycline approved yes target inhibitor Details