Receptor activity-modifying protein 3
Details
- Name
- Receptor activity-modifying protein 3
- Kind
- protein
- Synonyms
- Calcitonin-receptor-like receptor activity-modifying protein 3
- CRLR activity-modifying protein 3
- Gene Name
- RAMP3
- UniProtKB Entry
- O60896Swiss-Prot
- Organism
- Humans
- NCBI Taxonomy ID
- 9606
- Amino acid sequence
>lcl|BSEQ0016229|Receptor activity-modifying protein 3 METGALRRPQLLPLLLLLCGGCPRAGGCNETGMLERLPLCGKAFADMMGKVDVWKWCNLS EFIVYYESFTNCTEMEANVVGCYWPNPLAQGFITGIHRQFFSNCTVDRVHLEDPPDEVLI PLIVIPVVLTVAMAGLVVWRSKRTDTLL
- Number of residues
- 148
- Molecular Weight
- 16518.325
- Theoretical pI
- 5.15
- GO Classification
- Functionsadrenomedullin receptor activity / amylin receptor activity / amyloid-beta bindingProcessesadenylate cyclase-activating G protein-coupled receptor signaling pathway / adrenomedullin receptor signaling pathway / amylin receptor signaling pathway / cross-receptor inhibition within G protein-coupled receptor heterodimer / G protein-coupled receptor signaling pathway / G protein-coupled receptor signaling pathway involved in heart process / positive regulation of calcium-mediated signaling / positive regulation of ERK1 and ERK2 cascade / positive regulation of gene expression / positive regulation of phosphatidylinositol 3-kinase/protein kinase B signal transduction / positive regulation of protein kinase A signaling / positive regulation of protein localization to plasma membrane / response to amyloid-betaComponentsadrenomedullin receptor complex / amylin receptor complex 3
- General Function
- Plays a role in cardioprotection by reducing cardiac hypertrophy and perivascular fibrosis in a GPER1-dependent manner. Transports the calcitonin gene-related peptide type 1 receptor (CALCRL) and GPER1 to the plasma membrane. Acts as a receptor for adrenomedullin (AM) together with CALCRL
- Specific Function
- adrenomedullin receptor activity
- Pfam Domain Function
- RAMP (PF04901)
- Signal Regions
- 1-23
- Transmembrane Regions
- 119-138
- Cellular Location
- Cell membrane
- Gene sequence
>lcl|BSEQ0016230|Receptor activity-modifying protein 3 (RAMP3) ATGGAGACTGGAGCGCTGCGGCGCCCGCAACTTCTCCCGTTGCTGCTGCTGCTCTGCGGT GGGTGTCCCAGAGCAGGCGGCTGCAACGAGACAGGCATGTTGGAGAGGCTGCCCCTGTGT GGGAAGGCTTTCGCAGACATGATGGGCAAGGTGGACGTCTGGAAGTGGTGCAACCTGTCC GAGTTCATCGTGTACTATGAGAGTTTCACCAACTGCACCGAGATGGAGGCCAATGTCGTG GGCTGCTACTGGCCCAACCCCCTGGCCCAGGGCTTCATCACCGGCATCCACAGGCAGTTC TTCTCCAACTGCACCGTGGACAGGGTCCACTTGGAGGACCCCCCAGACGAGGTTCTCATC CCGCTGATCGTTATACCCGTCGTTCTGACTGTCGCCATGGCTGGCCTGGTGGTGTGGCGC AGCAAACGCACCGACACGCTGCTGTGA
- Chromosome Location
- 7
- Locus
- 7p13
- External Identifiers
Resource Link UniProtKB ID O60896 UniProtKB Entry Name RAMP3_HUMAN GenBank Protein ID 3171914 GenBank Gene ID AJ001016 GeneCard ID RAMP3 GenAtlas ID RAMP3 HGNC ID HGNC:9845 PDB ID(s) 6UUS, 6UVA, 7TZF, 8F0K, 8F2A, 8F2B KEGG ID hsa:10268 IUPHAR/Guide To Pharmacology ID 53 NCBI Gene ID 10268 - General References
- McLatchie LM, Fraser NJ, Main MJ, Wise A, Brown J, Thompson N, Solari R, Lee MG, Foord SM: RAMPs regulate the transport and ligand specificity of the calcitonin-receptor-like receptor. Nature. 1998 May 28;393(6683):333-9. [Article]
- Hillier LW, Fulton RS, Fulton LA, Graves TA, Pepin KH, Wagner-McPherson C, Layman D, Maas J, Jaeger S, Walker R, Wylie K, Sekhon M, Becker MC, O'Laughlin MD, Schaller ME, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Cordes M, Du H, Sun H, Edwards J, Bradshaw-Cordum H, Ali J, Andrews S, Isak A, Vanbrunt A, Nguyen C, Du F, Lamar B, Courtney L, Kalicki J, Ozersky P, Bielicki L, Scott K, Holmes A, Harkins R, Harris A, Strong CM, Hou S, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Leonard S, Rohlfing T, Rock SM, Tin-Wollam AM, Abbott A, Minx P, Maupin R, Strowmatt C, Latreille P, Miller N, Johnson D, Murray J, Woessner JP, Wendl MC, Yang SP, Schultz BR, Wallis JW, Spieth J, Bieri TA, Nelson JO, Berkowicz N, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Bedell JA, Mardis ER, Clifton SW, Chissoe SL, Marra MA, Raymond C, Haugen E, Gillett W, Zhou Y, James R, Phelps K, Iadanoto S, Bubb K, Simms E, Levy R, Clendenning J, Kaul R, Kent WJ, Furey TS, Baertsch RA, Brent MR, Keibler E, Flicek P, Bork P, Suyama M, Bailey JA, Portnoy ME, Torrents D, Chinwalla AT, Gish WR, Eddy SR, McPherson JD, Olson MV, Eichler EE, Green ED, Waterston RH, Wilson RK: The DNA sequence of human chromosome 7. Nature. 2003 Jul 10;424(6945):157-64. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Lenhart PM, Broselid S, Barrick CJ, Leeb-Lundberg LM, Caron KM: G-protein-coupled receptor 30 interacts with receptor activity-modifying protein 3 and confers sex-dependent cardioprotection. J Mol Endocrinol. 2013 Jul 3;51(1):191-202. doi: 10.1530/JME-13-0021. Print 2013. [Article]
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details Pramlintide approved, investigational yes target agonist Details