Calcitonin gene-related peptide 1
Details
- Name
- Calcitonin gene-related peptide 1
- Kind
- protein
- Synonyms
- Alpha-type CGRP
- CALC1
- Calcitonin gene-related peptide I
- CGRP-I
- Gene Name
- CALCA
- UniProtKB Entry
- P06881Swiss-Prot
- Organism
- Humans
- NCBI Taxonomy ID
- 9606
- Amino acid sequence
>lcl|BSEQ0055791|Calcitonin gene-related peptide 1 MGFQKFSPFLALSILVLLQAGSLHAAPFRSALESSPADPATLSEDEARLLLAALVQDYVQ MKASELEQEQEREGSRIIAQKRACDTATCVTHRLAGLLSRSGGVVKNNFVPTNVGSKAFG RRRRDLQA
- Number of residues
- 128
- Molecular Weight
- 13898.735
- Theoretical pI
- 9.4
- GO Classification
- Functionshormone activity / protein-containing complex binding / signaling receptor bindingProcessesadenylate cyclase-activating G protein-coupled receptor signaling pathway / calcitonin gene-related peptide receptor signaling pathway / G protein-coupled receptor internalization / nervous system process involved in regulation of systemic arterial blood pressure / phospholipase C-activating G protein-coupled receptor signaling pathway / regulation of cytosolic calcium ion concentration / vasodilation
- General Function
- CGRP induces vasodilation. It dilates a variety of vessels including the coronary, cerebral and systemic vasculature. Its abundance in the CNS also points toward a neurotransmitter or neuromodulator role. It also elevates platelet cAMP
- Specific Function
- hormone activity
- Pfam Domain Function
- Calc_CGRP_IAPP (PF00214)
- Signal Regions
- 1-25
- Transmembrane Regions
- Not Available
- Cellular Location
- Secreted
- Gene sequence
>lcl|BSEQ0002194|387 bp ATGGGCTTCCAAAAGTTCTCCCCCTTCCTGGCTCTCAGCATCTTGGTCCTGTTGCAGGCA GGCAGCCTCCATGCAGCACCATTCAGGTCTGCCCTGGAGAGCAGCCCAGCAGACCCGGCC ACGCTCAGTGAGGACGAAGCGCGCCTCCTGCTGGCTGCACTGGTGCAGGACTATGTGCAG ATGAAGGCCAGTGAGCTGGAGCAGGAGCAAGAGAGAGAGGGCTCCAGAATCATTGCCCAG AAGAGAGCCTGTGACACTGCCACCTGTGTGACTCATCGGCTGGCAGGCTTGCTGAGCAGA TCAGGGGGTGTGGTGAAGAACAACTTTGTGCCCACCAATGTGGGTTCCAAAGCCTTTGGC AGGCGCCGCAGGGACCTTCAAGCCTGA
- Chromosome Location
- 11
- Locus
- 11p15.2
- External Identifiers
Resource Link UniProtKB ID P06881 UniProtKB Entry Name CALCA_HUMAN GenBank Protein ID 179828 GenBank Gene ID M12667 GeneCard ID CALCA GenAtlas ID CALCA HGNC ID HGNC:1437 PDB ID(s) 6E3Y, 7KNU, 9AUC NCBI Gene ID 796 - General References
- Jonas V, Lin CR, Kawashima E, Semon D, Swanson LW, Mermod JJ, Evans RM, Rosenfeld MG: Alternative RNA processing events in human calcitonin/calcitonin gene-related peptide gene expression. Proc Natl Acad Sci U S A. 1985 Apr;82(7):1994-8. [Article]
- Broad PM, Symes AJ, Thakker RV, Craig RK: Structure and methylation of the human calcitonin/alpha-CGRP gene. Nucleic Acids Res. 1989 Sep 12;17(17):6999-7011. [Article]
- Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES, Sakaki Y: Human chromosome 11 DNA sequence and analysis including novel gene identification. Nature. 2006 Mar 23;440(7083):497-500. [Article]
- Nelkin BD, Rosenfeld KI, de Bustros A, Leong SS, Roos BA, Baylin SB: Structure and expression of a gene encoding human calcitonin and calcitonin gene related peptide. Biochem Biophys Res Commun. 1984 Sep 17;123(2):648-55. [Article]
- Edbrooke MR, Parker D, McVey JH, Riley JH, Sorenson GD, Pettengill OS, Craig RK: Expression of the human calcitonin/CGRP gene in lung and thyroid carcinoma. EMBO J. 1985 Mar;4(3):715-24. [Article]
- Steenbergh PH, Hoppener JW, Zandberg J, Van de Ven WJ, Jansz HS, Lips CJ: Calcitonin gene related peptide coding sequence is conserved in the human genome and is expressed in medullary thyroid carcinoma. J Clin Endocrinol Metab. 1984 Aug;59(2):358-60. [Article]
- Craig RK, Riley JH, Edbrooke MR, Broad PM, Foord SM, Al-Kazwini SJ, Holman JJ, Marshall I: Expression and function of the human calcitonin/alpha-CGRP gene in health and disease. Biochem Soc Symp. 1986;52:91-105. [Article]
- Morris HR, Panico M, Etienne T, Tippins J, Girgis SI, MacIntyre I: Isolation and characterization of human calcitonin gene-related peptide. Nature. 1984 Apr 19-25;308(5961):746-8. [Article]
- Petermann JB, Born W, Chang JY, Fischer JA: Identification in the human central nervous system, pituitary, and thyroid of a novel calcitonin gene-related peptide, and partial amino acid sequence in the spinal cord. J Biol Chem. 1987 Jan 15;262(2):542-5. [Article]
- Kitamura K, Kangawa K, Kawamoto M, Ichiki Y, Matsuo H, Eto T: Isolation and characterization of peptides which act on rat platelets, from a pheochromocytoma. Biochem Biophys Res Commun. 1992 May 29;185(1):134-41. [Article]
- Breeze AL, Harvey TS, Bazzo R, Campbell ID: Solution structure of human calcitonin gene-related peptide by 1H NMR and distance geometry with restrained molecular dynamics. Biochemistry. 1991 Jan 15;30(2):575-82. [Article]
- Hubbard JA, Martin SR, Chaplin LC, Bose C, Kelly SM, Price NC: Solution structures of calcitonin-gene-related-peptide analogues of calcitonin-gene-related peptide and amylin. Biochem J. 1991 May 1;275 ( Pt 3):785-8. [Article]
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details Olcegepant investigational unknown target Details Telcagepant investigational unknown target Details Eptinezumab approved, investigational yes target binderantibody Details Galcanezumab approved, investigational yes target antibody Details Fremanezumab approved, investigational yes target binderantibody Details