Deoxyuridine 5'-triphosphate nucleotidohydrolase
Details
- Name
- Deoxyuridine 5'-triphosphate nucleotidohydrolase
- Kind
- protein
- Synonyms
- 3.6.1.23
- dUTP pyrophosphatase
- dUTPase
- Gene Name
- dut
- UniProtKB Entry
- P9WNS5Swiss-Prot
- Organism
- Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv)
- NCBI Taxonomy ID
- 83332
- Amino acid sequence
>lcl|BSEQ0051205|Deoxyuridine 5'-triphosphate nucleotidohydrolase MSTTLAIVRLDPGLPLPSRAHDGDAGVDLYSAEDVELAPGRRALVRTGVAVAVPFGMVGL VHPRSGLATRVGLSIVNSPGTIDAGYRGEIKVALINLDPAAPIVVHRGDRIAQLLVQRVE LVELVEVSSFDEAGLASTSRGDGGHGSSGGHASL
- Number of residues
- 154
- Molecular Weight
- 15802.815
- Theoretical pI
- Not Available
- GO Classification
- FunctionsdUTP diphosphatase activity / magnesium ion bindingProcessesdUMP biosynthetic process / dUTP catabolic process / dUTP metabolic process / growth
- General Function
- This enzyme is involved in nucleotide metabolism: it produces dUMP, the immediate precursor of thymidine nucleotides and it decreases the intracellular concentration of dUTP so that uracil cannot be incorporated into DNA.
- Specific Function
- dUTP diphosphatase activity
- Pfam Domain Function
- Not Available
- Signal Regions
- Not Available
- Transmembrane Regions
- Not Available
- Cellular Location
- Not Available
- Gene sequence
>lcl|BSEQ0051206|Deoxyuridine 5'-triphosphate nucleotidohydrolase (dut) GTGTCGACCACTCTGGCGATCGTCCGCCTCGACCCCGGGCTCCCGCTGCCCAGCCGCGCT CACGACGGCGACGCCGGCGTTGATCTCTACAGCGCCGAAGACGTCGAGCTGGCACCTGGG CGCCGCGCCCTGGTACGGACGGGTGTTGCGGTCGCCGTCCCGTTCGGCATGGTCGGGCTG GTCCATCCGCGCTCCGGGTTGGCCACGCGGGTGGGGCTTTCGATCGTCAACAGTCCGGGC ACCATCGACGCGGGTTATCGTGGGGAGATCAAGGTGGCCCTGATCAACTTGGACCCAGCC GCGCCCATCGTGGTACATCGCGGTGACCGAATCGCCCAGTTGCTAGTGCAACGGGTTGAG TTGGTCGAGCTGGTCGAGGTCTCGTCGTTCGACGAGGCCGGGCTGGCCTCGACATCCCGC GGCGACGGTGGCCACGGTTCCTCCGGCGGACATGCGAGTTTGTGA
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P9WNS5 UniProtKB Entry Name DUT_MYCTU PDB ID(s) 1MQ7, 1SIX, 1SJN, 1SLH, 1SM8, 1SMC, 1SNF, 2PY4, 3H6D, 3HZA, 3I93, 3LOJ, 4GCY, 5ECT, 5EDD KEGG ID mtu:Rv2697c NCBI Gene ID 887290 - General References
- Cole ST, Brosch R, Parkhill J, Garnier T, Churcher C, Harris D, Gordon SV, Eiglmeier K, Gas S, Barry CE 3rd, Tekaia F, Badcock K, Basham D, Brown D, Chillingworth T, Connor R, Davies R, Devlin K, Feltwell T, Gentles S, Hamlin N, Holroyd S, Hornsby T, Jagels K, Krogh A, McLean J, Moule S, Murphy L, Oliver K, Osborne J, Quail MA, Rajandream MA, Rogers J, Rutter S, Seeger K, Skelton J, Squares R, Squares S, Sulston JE, Taylor K, Whitehead S, Barrell BG: Deciphering the biology of Mycobacterium tuberculosis from the complete genome sequence. Nature. 1998 Jun 11;393(6685):537-44. [Article]
- Kelkar DS, Kumar D, Kumar P, Balakrishnan L, Muthusamy B, Yadav AK, Shrivastava P, Marimuthu A, Anand S, Sundaram H, Kingsbury R, Harsha HC, Nair B, Prasad TS, Chauhan DS, Katoch K, Katoch VM, Kumar P, Chaerkady R, Ramachandran S, Dash D, Pandey A: Proteogenomic analysis of Mycobacterium tuberculosis by high resolution mass spectrometry. Mol Cell Proteomics. 2011 Dec;10(12):M111.011627. doi: 10.1074/mcp.M111.011445. Epub 2011 Oct 3. [Article]
- Chan S, Segelke B, Lekin T, Krupka H, Cho US, Kim MY, So M, Kim CY, Naranjo CM, Rogers YC, Park MS, Waldo GS, Pashkov I, Cascio D, Perry JL, Sawaya MR: Crystal structure of the Mycobacterium tuberculosis dUTPase: insights into the catalytic mechanism. J Mol Biol. 2004 Aug 6;341(2):503-17. [Article]
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details 2'-Deoxyuridine 5'-alpha,beta-imido-triphosphate experimental unknown target Details Deoxyuridine-5'-Triphosphate experimental unknown target Details Deoxyuridine-5'-Diphosphate experimental unknown target Details Deoxyuridine monophosphate experimental unknown target Details