Endo-1,4-beta-xylanase
Details
- Name
- Endo-1,4-beta-xylanase
- Kind
- protein
- Synonyms
- 3.2.1.8
- Gene Name
- Not Available
- UniProtKB Entry
- Q7SIE2TrEMBL
- Organism
- Bacillus agaradhaerens
- NCBI Taxonomy ID
- 76935
- Amino acid sequence
>lcl|BSEQ0016935|Endo-1,4-beta-xylanase QIVTDNSIGNHDGYDYEFWKDSGGSGTMILNHGGTFSAQWNNVNNILFRKGKKFNETQTH QQVGNMSINYGANFQPNGNAYLCVYGWTVDPLVAYYIVDSWGNWRPPGATPKGTITVDGG TYDIYETLRVNQPSIKGIATFKQYWSVRRSKRTSGTISVSNHFRAWENLGMNMGKMYEVA LTVEGYQSSGSANVYSNTLRINGNPLSTI
- Number of residues
- 209
- Molecular Weight
- 23307.82
- Theoretical pI
- 9.12
- GO Classification
- Functionsendo-1,4-beta-xylanase activityProcessesxylan catabolic process
- General Function
- Not Available
- Specific Function
- endo-1,4-beta-xylanase activity
- Pfam Domain Function
- Glyco_hydro_11 (PF00457)
- Signal Regions
- Not Available
- Transmembrane Regions
- Not Available
- Cellular Location
- Cytoplasmic
- Gene sequence
- Not Available
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID Q7SIE2 UniProtKB Entry Name Q7SIE2_BACAG PDB ID(s) 1H4H - General References
- Sabini E, Sulzenbacher G, Dauter M, Dauter Z, Jorgensen PL, Schulein M, Dupont C, Davies GJ, Wilson KS: Catalysis and specificity in enzymatic glycoside hydrolysis: a 2,5B conformation for the glycosyl-enzyme intermediate revealed by the structure of the Bacillus agaradhaerens family 11 xylanase. Chem Biol. 1999 Jul;6(7):483-92. [Article]
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details Pidolic acid approved, investigational unknown target Details alpha-D-Xylopyranose experimental unknown target Details