Apolipoprotein C-III

Details

Name
Apolipoprotein C-III
Kind
protein
Synonyms
  • Apo-CIII
  • ApoC-III
  • Apolipoprotein C3
Gene Name
APOC3
UniProtKB Entry
P02656Swiss-Prot
Organism
Humans
NCBI Taxonomy ID
9606
Amino acid sequence
>lcl|BSEQ0017855|Apolipoprotein C-III
MQPRVLLVVALLALLASARASEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQAR
GWVTDGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSAVAA
Number of residues
99
Molecular Weight
10852.19
Theoretical pI
Not Available
GO Classification
Processes
G protein-coupled receptor signaling pathway
Components
collagen-containing extracellular matrix
General Function
Component of triglyceride-rich very low density lipoproteins (VLDL) and high density lipoproteins (HDL) in plasma (PubMed:18201179, PubMed:22510806). Plays a multifaceted role in triglyceride homeostasis (PubMed:18201179, PubMed:22510806). Intracellularly, promotes hepatic very low density lipoprotein 1 (VLDL1) assembly and secretion; extracellularly, attenuates hydrolysis and clearance of triglyceride-rich lipoproteins (TRLs) (PubMed:18201179, PubMed:22510806). Impairs the lipolysis of TRLs by inhibiting lipoprotein lipase and the hepatic uptake of TRLs by remnant receptors (PubMed:18201179, PubMed:22510806). Formed of several curved helices connected via semiflexible hinges, so that it can wrap tightly around the curved micelle surface and easily adapt to the different diameters of its natural binding partners (PubMed:18408013)
Specific Function
Cholesterol binding
Pfam Domain Function
Signal Regions
1-20
Transmembrane Regions
Not Available
Cellular Location
Secreted
Gene sequence
>lcl|BSEQ0017856|Apolipoprotein C-III (APOC3)
ATGCAGCCCCGGGTACTCCTTGTTGTTGCCCTCCTGGCGCTCCTGGCCTCTGCCCGAGCT
TCAGAGGCCGAGGATGCCTCCCTTCTCAGCTTCATGCAGGGTTACATGAAGCACGCCACC
AAGACCGCCAAGGATGCACTGAGCAGCGTGCAGGAGTCCCAGGTGGCCCAGCAGGCCAGG
GGCTGGGTGACCGATGGCTTCAGTTCCCTGAAAGACTACTGGAGCACCGTTAAGGACAAG
TTCTCTGAGTTCTGGGATTTGGACCCTGAGGTCAGACCAACTTCAGCCGTGGCTGCCTGA
Chromosome Location
11
Locus
11q23.3
External Identifiers
ResourceLink
UniProtKB IDP02656
UniProtKB Entry NameAPOC3_HUMAN
GeneCard IDAPOC3
HGNC IDHGNC:610
PDB ID(s)2JQ3
KEGG IDhsa:345
NCBI Gene ID345
General References
  1. Protter AA, Levy-Wilson B, Miller J, Bencen G, White T, Seilhamer JJ: Isolation and sequence analysis of the human apolipoprotein CIII gene and the intergenic region between the apo AI and apo CIII genes. DNA. 1984 Dec;3(6):449-56. [Article]
  2. Levy-Wilson B, Appleby V, Protter A, Auperin D, Seilhamer JJ: Isolation and DNA sequence of full-length cDNA for human preapolipoprotein CIII. DNA. 1984 Oct;3(5):359-64. [Article]
  3. Karathanasis SK, Zannis VI, Breslow JL: Isolation and characterization of cDNA clones corresponding to two different human apoC-III alleles. J Lipid Res. 1985 Apr;26(4):451-6. [Article]
  4. Sharpe CR, Sidoli A, Shelley CS, Lucero MA, Shoulders CC, Baralle FE: Human apolipoproteins AI, AII, CII and CIII. cDNA sequences and mRNA abundance. Nucleic Acids Res. 1984 May 11;12(9):3917-32. [Article]
  5. Fullerton SM, Buchanan AV, Sonpar VA, Taylor SL, Smith JD, Carlson CS, Salomaa V, Stengard JH, Boerwinkle E, Clark AG, Nickerson DA, Weiss KM: The effects of scale: variation in the APOA1/C3/A4/A5 gene cluster. Hum Genet. 2004 Jun;115(1):36-56. Epub 2004 Apr 24. [Article]
  6. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
  7. Hospattankar AV, Brewer HB Jr, Ronan R, Fairwell T: Amino acid sequence of human plasma apolipoprotein C-III from normolipidemic subjects. FEBS Lett. 1986 Mar 3;197(1-2):67-73. [Article]
  8. Brewer HB Jr, Shulman R, Herbert P, Ronan R, Wehrly K: The complete amino acid sequence of alanine apolipoprotein (apoC-3), and apolipoprotein from human plasma very low density lipoproteins. J Biol Chem. 1974 Aug 10;249(15):4975-84. [Article]
  9. Chan DC, Chen MM, Ooi EM, Watts GF: An ABC of apolipoprotein C-III: a clinically useful new cardiovascular risk factor? Int J Clin Pract. 2008 May;62(5):799-809. doi: 10.1111/j.1742-1241.2007.01678.x. Epub 2008 Jan 14. [Article]
  10. Nilsson J, Ruetschi U, Halim A, Hesse C, Carlsohn E, Brinkmalm G, Larson G: Enrichment of glycopeptides for glycan structure and attachment site identification. Nat Methods. 2009 Nov;6(11):809-11. doi: 10.1038/nmeth.1392. Epub 2009 Oct 18. [Article]
  11. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [Article]
  12. Yao Z, Wang Y: Apolipoprotein C-III and hepatic triglyceride-rich lipoprotein production. Curr Opin Lipidol. 2012 Jun;23(3):206-12. doi: 10.1097/MOL.0b013e328352dc70. [Article]
  13. Nicolardi S, van der Burgt YE, Dragan I, Hensbergen PJ, Deelder AM: Identification of new apolipoprotein-CIII glycoforms with ultrahigh resolution MALDI-FTICR mass spectrometry of human sera. J Proteome Res. 2013 May 3;12(5):2260-8. doi: 10.1021/pr400136p. Epub 2013 Apr 5. [Article]
  14. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [Article]
  15. Maeda H, Hashimoto RK, Ogura T, Hiraga S, Uzawa H: Molecular cloning of a human apoC-III variant: Thr 74----Ala 74 mutation prevents O-glycosylation. J Lipid Res. 1987 Dec;28(12):1405-9. [Article]
  16. von Eckardstein A, Holz H, Sandkamp M, Weng W, Funke H, Assmann G: Apolipoprotein C-III(Lys58----Glu). Identification of an apolipoprotein C-III variant in a family with hyperalphalipoproteinemia. J Clin Invest. 1991 May;87(5):1724-31. [Article]

Associated Data

Drug Relations
DrugDrug groupPharmacological action?TypeActionsDetails
Copperapproved, investigationalunknowntargetDetails
Volanesorsenapproved, investigationalyestargetinhibitorantisense oligonucleotideDetails