Apolipoprotein A-IV

Details

Name
Apolipoprotein A-IV
Kind
protein
Synonyms
  • Apo-AIV
  • ApoA-IV
  • Apolipoprotein A4
Gene Name
APOA4
UniProtKB Entry
P06727Swiss-Prot
Organism
Humans
NCBI Taxonomy ID
9606
Amino acid sequence
>lcl|BSEQ0055760|Apolipoprotein A-IV
MFLKAVVLTLALVAVAGARAEVSADQVATVMWDYFSQLSNNAKEAVEHLQKSELTQQLNA
LFQDKLGEVNTYAGDLQKKLVPFATELHERLAKDSEKLKEEIGKELEELRARLLPHANEV
SQKIGDNLRELQQRLEPYADQLRTQVSTQAEQLRRQLTPYAQRMERVLRENADSLQASLR
PHADELKAKIDQNVEELKGRLTPYADEFKVKIDQTVEELRRSLAPYAQDTQEKLNHQLEG
LTFQMKKNAEELKARISASAEELRQRLAPLAEDVRGNLRGNTEGLQKSLAELGGHLDQQV
EEFRRRVEPYGENFNKALVQQMEQLRQKLGPHAGDVEGHLSFLEKDLRDKVNSFFSTFKE
KESQDKTLSLPELEQQQEQQQEQQQEQVQMLAPLES
Number of residues
396
Molecular Weight
45371.745
Theoretical pI
Not Available
GO Classification
Functions
cholesterol transfer activity / identical protein binding / phospholipid binding
Processes
acylglycerol homeostasis / lipid catabolic process / peripheral nervous system axon regeneration / positive regulation of CoA-transferase activity / response to triglyceride
Components
collagen-containing extracellular matrix / extracellular vesicle / low-density lipoprotein particle / synapse
General Function
May have a role in chylomicrons and VLDL secretion and catabolism. Required for efficient activation of lipoprotein lipase by ApoC-II; potent activator of LCAT. Apoa-IV is a major component of HDL and chylomicrons
Specific Function
Antioxidant activity
Pfam Domain Function
Signal Regions
1-20
Transmembrane Regions
Not Available
Cellular Location
Secreted
Gene sequence
Not Available
Chromosome Location
11
Locus
11q23.3
External Identifiers
ResourceLink
UniProtKB IDP06727
UniProtKB Entry NameAPOA4_HUMAN
GeneCard IDAPOA4
HGNC IDHGNC:602
PDB ID(s)3S84
KEGG IDhsa:337
NCBI Gene ID337
General References
  1. Karathanasis SK, Yunis I, Zannis VI: Structure, evolution, and tissue-specific synthesis of human apolipoprotein AIV. Biochemistry. 1986 Jul 1;25(13):3962-70. [Article]
  2. Karathanasis SK, Oettgen P, Haddad IA, Antonarakis SE: Structure, evolution, and polymorphisms of the human apolipoprotein A4 gene (APOA4). Proc Natl Acad Sci U S A. 1986 Nov;83(22):8457-61. [Article]
  3. Elshourbagy NA, Walker DW, Paik YK, Boguski MS, Freeman M, Gordon JI, Taylor JM: Structure and expression of the human apolipoprotein A-IV gene. J Biol Chem. 1987 Jun 15;262(17):7973-81. [Article]
  4. Yang CY, Gu ZW, Chong IS, Xiong WJ, Rosseneu M, Yang HX, Lee BR, Gotto AM Jr, Chan L: The primary structure of human apolipoprotein A-IV. Biochim Biophys Acta. 1989 Apr 3;1002(2):231-7. [Article]
  5. Fullerton SM, Buchanan AV, Sonpar VA, Taylor SL, Smith JD, Carlson CS, Salomaa V, Stengard JH, Boerwinkle E, Clark AG, Nickerson DA, Weiss KM: The effects of scale: variation in the APOA1/C3/A4/A5 gene cluster. Hum Genet. 2004 Jun;115(1):36-56. Epub 2004 Apr 24. [Article]
  6. Taylor TD, Noguchi H, Totoki Y, Toyoda A, Kuroki Y, Dewar K, Lloyd C, Itoh T, Takeda T, Kim DW, She X, Barlow KF, Bloom T, Bruford E, Chang JL, Cuomo CA, Eichler E, FitzGerald MG, Jaffe DB, LaButti K, Nicol R, Park HS, Seaman C, Sougnez C, Yang X, Zimmer AR, Zody MC, Birren BW, Nusbaum C, Fujiyama A, Hattori M, Rogers J, Lander ES, Sakaki Y: Human chromosome 11 DNA sequence and analysis including novel gene identification. Nature. 2006 Mar 23;440(7083):497-500. [Article]
  7. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
  8. Elshourbagy NA, Walker DW, Boguski MS, Gordon JI, Taylor JM: The nucleotide and derived amino acid sequence of human apolipoprotein A-IV mRNA and the close linkage of its gene to the genes of apolipoproteins A-I and C-III. J Biol Chem. 1986 Feb 15;261(5):1998-2002. [Article]
  9. Gordon JI, Bisgaier CL, Sims HF, Sachdev OP, Glickman RM, Strauss AW: Biosynthesis of human preapolipoprotein A-IV. J Biol Chem. 1984 Jan 10;259(1):468-74. [Article]
  10. Lohse P, Kindt MR, Rader DJ, Brewer HB Jr: Genetic polymorphism of human plasma apolipoprotein A-IV is due to nucleotide substitutions in the apolipoprotein A-IV gene. J Biol Chem. 1990 Jun 15;265(17):10061-4. [Article]
  11. Lohse P, Kindt MR, Rader DJ, Brewer HB Jr: Human plasma apolipoproteins A-IV-0 and A-IV-3. Molecular basis for two rare variants of apolipoprotein A-IV-1. J Biol Chem. 1990 Jul 25;265(21):12734-9. [Article]
  12. Burkard TR, Planyavsky M, Kaupe I, Breitwieser FP, Burckstummer T, Bennett KL, Superti-Furga G, Colinge J: Initial characterization of the human central proteome. BMC Syst Biol. 2011 Jan 26;5:17. doi: 10.1186/1752-0509-5-17. [Article]
  13. Deng X, Morris J, Dressmen J, Tubb MR, Tso P, Jerome WG, Davidson WS, Thompson TB: The structure of dimeric apolipoprotein A-IV and its mechanism of self-association. Structure. 2012 May 9;20(5):767-79. doi: 10.1016/j.str.2012.02.020. [Article]
  14. Tenkanen H, Lukka M, Jauhiainen M, Metso J, Baumann M, Peltonen L, Ehnholm C: The mutation causing the common apolipoprotein A-IV polymorphism is a glutamine to histidine substitution of amino acid 360. Arterioscler Thromb. 1991 Jul-Aug;11(4):851-6. [Article]
  15. Lohse P, Kindt MR, Rader DJ, Brewer HB Jr: Three genetic variants of human plasma apolipoprotein A-IV. apoA-IV-1(Thr347----Ser), apoA-IV-0(Lys167----Glu,Gln360----His), and apoA-IV-3(Glu165----Lys). J Biol Chem. 1991 Jul 25;266(21):13513-8. [Article]
  16. von Eckardstein A, Funke H, Schulte M, Erren M, Schulte H, Assmann G: Nonsynonymous polymorphic sites in the apolipoprotein (apo) A-IV gene are associated with changes in the concentration of apo B- and apo A-I-containing lipoproteins in a normal population. Am J Hum Genet. 1992 May;50(5):1115-28. [Article]
  17. Tenkanen H, Koskinen P, Metso J, Baumann M, Lukka M, Kauppinen-Makelin R, Kontula K, Taskinen MR, Manttari M, Manninen V, et al.: A novel polymorphism of apolipoprotein A-IV is the result of an asparagine to serine substitution at residue 127. Biochim Biophys Acta. 1992 Jan 16;1138(1):27-33. [Article]
  18. Kamboh MI, Williams ER, Law JC, Aston CE, Bunker CH, Ferrell RE, Pollitzer WS: Molecular basis of a unique African variant (A-IV 5) of human apolipoprotein A-IV and its significance in lipid metabolism. Genet Epidemiol. 1992;9(6):379-88. [Article]
  19. Menzel HJ, Dieplinger H, Sandholzer C, Karadi I, Utermann G, Csaszar A: Apolipoprotein A-IV polymorphism in the Hungarian population: gene frequencies, effect on lipid levels, and sequence of two new variants. Hum Mutat. 1995;5(1):58-65. [Article]
  20. Deeb SS, Nevin DN, Iwasaki L, Brunzell JD: Two novel apolipoprotein A-IV variants in individuals with familial combined hyperlipidemia and diminished levels of lipoprotein lipase activity. Hum Mutat. 1996;8(4):319-25. [Article]
  21. Halushka MK, Fan JB, Bentley K, Hsie L, Shen N, Weder A, Cooper R, Lipshutz R, Chakravarti A: Patterns of single-nucleotide polymorphisms in candidate genes for blood-pressure homeostasis. Nat Genet. 1999 Jul;22(3):239-47. [Article]
  22. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [Article]

Associated Data

Drug Relations
DrugDrug groupPharmacological action?TypeActionsDetails
Copperapproved, investigationalunknowntargetDetails
Zincapproved, investigationalunknowntargetDetails
Zinc acetateapproved, investigationalunknowntargetDetails