Immunoglobulin lambda variable 3-21
Details
- Name
- Immunoglobulin lambda variable 3-21
- Kind
- protein
- Synonyms
- Ig lambda chain V-III region LOI
- Ig lambda chain V-V region DEL
- Ig lambda chain V-VII region MOT
- Gene Name
- IGLV3-21
- UniProtKB Entry
- P80748Swiss-Prot
- Organism
- Humans
- NCBI Taxonomy ID
- 9606
- Amino acid sequence
>lcl|BSEQ0049869|Immunoglobulin lambda variable 3-21 MAWTVLLLGLLSHCTGSVTSYVLTQPPSVSVAPGQTARITCGGNNIGSKSVHWYQQKPGQ APVLVVYDDSDRPSGIPERFSGSNSGNTATLTISRVEAGDEADYYCQVWDSSSDHPT
- Number of residues
- 117
- Molecular Weight
- 12445.65
- Theoretical pI
- Not Available
- GO Classification
- Processesadaptive immune responseComponentsextracellular space / immunoglobulin complex
- General Function
- V region of the variable domain of immunoglobulin light chains that participates in the antigen recognition (PubMed:24600447). Immunoglobulins, also known as antibodies, are membrane-bound or secreted glycoproteins produced by B lymphocytes. In the recognition phase of humoral immunity, the membrane-bound immunoglobulins serve as receptors which, upon binding of a specific antigen, trigger the clonal expansion and differentiation of B lymphocytes into immunoglobulins-secreting plasma cells. Secreted immunoglobulins mediate the effector phase of humoral immunity, which results in the elimination of bound antigens (PubMed:20176268, PubMed:22158414). The antigen binding site is formed by the variable domain of one heavy chain, together with that of its associated light chain. Thus, each immunoglobulin has two antigen binding sites with remarkable affinity for a particular antigen. The variable domains are assembled by a process called V-(D)-J rearrangement and can then be subjected to somatic hypermutations which, after exposure to antigen and selection, allow affinity maturation for a particular antigen (PubMed:17576170, PubMed:20176268)
- Specific Function
- Antigen binding
- Pfam Domain Function
- V-set (PF07686)
- Signal Regions
- 1-17
- Transmembrane Regions
- Not Available
- Cellular Location
- Secreted
- Gene sequence
- Not Available
- Chromosome Location
- Not Available
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID P80748 UniProtKB Entry Name LV321_HUMAN GeneCard ID IGLV3-21 HGNC ID HGNC:5905 - General References
- Dunham I, Shimizu N, Roe BA, Chissoe S, Hunt AR, Collins JE, Bruskiewich R, Beare DM, Clamp M, Smink LJ, Ainscough R, Almeida JP, Babbage A, Bagguley C, Bailey J, Barlow K, Bates KN, Beasley O, Bird CP, Blakey S, Bridgeman AM, Buck D, Burgess J, Burrill WD, O'Brien KP, et al.: The DNA sequence of human chromosome 22. Nature. 1999 Dec 2;402(6761):489-95. [Article]
- Kojima M, Odani S, Ikenaka T: Amino acid sequence of the lambda type light chain of a human IgGl myeloma protein (MOT) with unusual antigenicity: a possible new subgroup of lambda chain having a unique N-terminal sequence. Mol Immunol. 1980 Nov;17(11):1407-14. [Article]
- Eulitz M: A new subgroup of human L-chains of the lambda-type. Primary structure of Bence-Jones protein DEL. Eur J Biochem. 1974 Dec 16;50(1):49-69. [Article]
- Jokiranta TS, Solomon A, Pangburn MK, Zipfel PF, Meri S: Nephritogenic lambda light chain dimer: a unique human miniautoantibody against complement factor H. J Immunol. 1999 Oct 15;163(8):4590-6. [Article]
- Lefranc MP: Nomenclature of the human immunoglobulin lambda (IGL) genes. Exp Clin Immunogenet. 2001;18(4):242-54. [Article]
- Teng G, Papavasiliou FN: Immunoglobulin somatic hypermutation. Annu Rev Genet. 2007;41:107-20. [Article]
- Schroeder HW Jr, Cavacini L: Structure and function of immunoglobulins. J Allergy Clin Immunol. 2010 Feb;125(2 Suppl 2):S41-52. doi: 10.1016/j.jaci.2009.09.046. [Article]
- McHeyzer-Williams M, Okitsu S, Wang N, McHeyzer-Williams L: Molecular programming of B cell memory. Nat Rev Immunol. 2011 Dec 9;12(1):24-34. doi: 10.1038/nri3128. [Article]
- Lefranc MP: Immunoglobulin and T Cell Receptor Genes: IMGT((R)) and the Birth and Rise of Immunoinformatics. Front Immunol. 2014 Feb 5;5:22. doi: 10.3389/fimmu.2014.00022. eCollection 2014. [Article]
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details Zinc approved, investigational unknown target Details Zinc acetate approved, investigational unknown target Details