Insulin-like growth factor-binding protein 1

Details

Name
Insulin-like growth factor-binding protein 1
Kind
protein
Synonyms
  • IBP-1
  • IBP1
  • IGF-binding protein 1
  • IGFBP-1
  • Placental protein 12
  • PP12
Gene Name
IGFBP1
UniProtKB Entry
P08833Swiss-Prot
Organism
Humans
NCBI Taxonomy ID
9606
Amino acid sequence
>lcl|BSEQ0052008|Insulin-like growth factor-binding protein 1
MSEVPVARVWLVLLLLTVQVGVTAGAPWQCAPCSAEKLALCPPVSASCSEVTRSAGCGCC
PMCALPLGAACGVATARCARGLSCRALPGEQQPLHALTRGQGACVQESDASAPHAAEAGS
PESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGSKALHVTNIKKWKEPCRIEL
YRVVESLAKAQETSGEEISKFYLPNCNKNGFYHSRQCETSMDGEAGLCWCVYPWNGKRIP
GSPEIRGDPNCQIYFNVQN
Number of residues
259
Molecular Weight
27903.38
Theoretical pI
Not Available
GO Classification
Processes
response to organic cyclic compound
General Function
IGF-binding proteins prolong the half-life of the IGFs and have been shown to either inhibit or stimulate the growth promoting effects of the IGFs on cell culture. They alter the interaction of IGFs with their cell surface receptors. Promotes cell migration
Specific Function
Insulin-like growth factor binding
Pfam Domain Function
Signal Regions
1-25
Transmembrane Regions
Not Available
Cellular Location
Secreted
Gene sequence
>lcl|BSEQ0052009|Insulin-like growth factor-binding protein 1 (IGFBP1)
ATGTCAGAGGTCCCCGTTGCTCGCGTCTGGCTGGTACTGCTCCTGCTGACTGTCCAGGTC
GGCGTGACAGCCGGCGCTCCGTGGCAGTGCGCGCCCTGCTCCGCCGAGAAGCTCGCGCTC
TGCCCGCCGGTGTCCGCCTCGTGCTCGGAGGTCACCCGGTCCGCCGGCTGCGGCTGTTGC
CCGATGTGCGCCCTGCCTCTGGGCGCCGCGTGCGGCGTGGCGACTGCACGCTGCGCCCGG
GGACTCAGTTGCCGCGCGCTGCCGGGGGAGCAGCAACCTCTGCACGCCCTCACCCGCGGC
CAAGGCGCCTGCGTGCAGGAGTCTGACGCCTCCGCTCCCCATGCTGCAGAGGCAGGGAGC
CCTGAAAGCCCAGAGAGCACGGAGATAACTGAGGAGGAGCTCCTGGATAATTTCCATCTG
ATGGCCCCTTCTGAAGAGGATCATTCCATCCTTTGGGACGCCATCAGTACCTATGATGGC
TCGAAGGCTCTCCATGTCACCAACATCAAAAAATGGAAGGAGCCCTGCCGAATAGAACTC
TACAGAGTCGTAGAGAGTTTAGCCAAGGCACAGGAGACATCAGGAGAAGAAATTTCCAAA
TTTTACCTGCCAAACTGCAACAAGAATGGATTTTATCACAGCAGACAGTGTGAGACATCC
ATGGATGGAGAGGCGGGACTCTGCTGGTGCGTCTACCCTTGGAATGGGAAGAGGATCCCT
GGGTCTCCAGAGATCAGGGGAGACCCCAACTGCCAGATATATTTTAATGTACAAAACTGA
Chromosome Location
7
Locus
7p12.3
External Identifiers
ResourceLink
UniProtKB IDP08833
UniProtKB Entry NameIBP1_HUMAN
GeneCard IDIGFBP1
HGNC IDHGNC:5469
PDB ID(s)1ZT3, 1ZT5, 2DSQ
KEGG IDhsa:3484
NCBI Gene ID3484
General References
  1. Brinkman A, Groffen C, Kortleve DJ, Geurts van Kessel A, Drop SL: Isolation and characterization of a cDNA encoding the low molecular weight insulin-like growth factor binding protein (IBP-1). EMBO J. 1988 Aug;7(8):2417-23. [Article]
  2. Brewer MT, Stetler GL, Squires CH, Thompson RC, Busby WH, Clemmons DR: Cloning, characterization, and expression of a human insulin-like growth factor binding protein. Biochem Biophys Res Commun. 1988 May 16;152(3):1289-97. [Article]
  3. Grundmann U, Nerlich C, Bohn H, Rein T: Cloning of cDNA encoding human placental protein 12 (PP12): binding protein for IGF I and somatomedin. Nucleic Acids Res. 1988 Sep 12;16(17):8711. [Article]
  4. Julkunen M, Koistinen R, Aalto-Setala K, Seppala M, Janne OA, Kontula K: Primary structure of human insulin-like growth factor-binding protein/placental protein 12 and tissue-specific expression of its mRNA. FEBS Lett. 1988 Aug 29;236(2):295-302. [Article]
  5. Lee YL, Hintz RL, James PM, Lee PD, Shively JE, Powell DR: Insulin-like growth factor (IGF) binding protein complementary deoxyribonucleic acid from human HEP G2 hepatoma cells: predicted protein sequence suggests an IGF binding domain different from those of the IGF-I and IGF-II receptors. Mol Endocrinol. 1988 May;2(5):404-11. [Article]
  6. Cubbage ML, Suwanichkul A, Powell DR: Structure of the human chromosomal gene for the 25 kilodalton insulin-like growth factor binding protein. Mol Endocrinol. 1989 May;3(5):846-51. [Article]
  7. Brinkman A, Groffen CA, Kortleve DJ, Drop SL: Organization of the gene encoding the insulin-like growth factor binding protein IBP-1. Biochem Biophys Res Commun. 1988 Dec 30;157(3):898-907. [Article]
  8. Ehrenborg E, Larsson C, Stern I, Janson M, Powell DR, Luthman H: Contiguous localization of the genes encoding human insulin-like growth factor binding proteins 1 (IGBP1) and 3 (IGBP3) on chromosome 7. Genomics. 1992 Mar;12(3):497-502. [Article]
  9. Scherer SW, Cheung J, MacDonald JR, Osborne LR, Nakabayashi K, Herbrick JA, Carson AR, Parker-Katiraee L, Skaug J, Khaja R, Zhang J, Hudek AK, Li M, Haddad M, Duggan GE, Fernandez BA, Kanematsu E, Gentles S, Christopoulos CC, Choufani S, Kwasnicka D, Zheng XH, Lai Z, Nusskern D, Zhang Q, Gu Z, Lu F, Zeesman S, Nowaczyk MJ, Teshima I, Chitayat D, Shuman C, Weksberg R, Zackai EH, Grebe TA, Cox SR, Kirkpatrick SJ, Rahman N, Friedman JM, Heng HH, Pelicci PG, Lo-Coco F, Belloni E, Shaffer LG, Pober B, Morton CC, Gusella JF, Bruns GA, Korf BR, Quade BJ, Ligon AH, Ferguson H, Higgins AW, Leach NT, Herrick SR, Lemyre E, Farra CG, Kim HG, Summers AM, Gripp KW, Roberts W, Szatmari P, Winsor EJ, Grzeschik KH, Teebi A, Minassian BA, Kere J, Armengol L, Pujana MA, Estivill X, Wilson MD, Koop BF, Tosi S, Moore GE, Boright AP, Zlotorynski E, Kerem B, Kroisel PM, Petek E, Oscier DG, Mould SJ, Dohner H, Dohner K, Rommens JM, Vincent JB, Venter JC, Li PW, Mural RJ, Adams MD, Tsui LC: Human chromosome 7: DNA sequence and biology. Science. 2003 May 2;300(5620):767-72. Epub 2003 Apr 10. [Article]
  10. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
  11. Dolcini L, Sala A, Campagnoli M, Labo S, Valli M, Visai L, Minchiotti L, Monaco HL, Galliano M: Identification of the amniotic fluid insulin-like growth factor binding protein-1 phosphorylation sites and propensity to proteolysis of the isoforms. FEBS J. 2009 Oct;276(20):6033-46. doi: 10.1111/j.1742-4658.2009.07318.x. Epub 2009 Sep 17. [Article]
  12. Luthman H, Soderling-Barros J, Persson B, Engberg C, Stern I, Lake M, Franzen SA, Israelsson M, Raden B, Lindgren B, et al.: Human insulin-like growth-factor-binding protein. Low-molecular-mass form: protein sequence and cDNA cloning. Eur J Biochem. 1989 Mar 15;180(2):259-65. [Article]
  13. Busby WH Jr, Klapper DG, Clemmons DR: Purification of a 31,000-dalton insulin-like growth factor binding protein from human amniotic fluid. Isolation of two forms with different biologic actions. J Biol Chem. 1988 Oct 5;263(28):14203-10. [Article]
  14. Brinkman A, Kortleve DJ, Schuller AG, Zwarthoff EC, Drop SL: Site-directed mutagenesis of the N-terminal region of IGF binding protein 1; analysis of IGF binding capability. FEBS Lett. 1991 Oct 21;291(2):264-8. [Article]
  15. Jones JI, Busby WH Jr, Wright G, Smith CE, Kimack NM, Clemmons DR: Identification of the sites of phosphorylation in insulin-like growth factor binding protein-1. Regulation of its affinity by phosphorylation of serine 101. J Biol Chem. 1993 Jan 15;268(2):1125-31. [Article]
  16. Neumann GM, Bach LA: The N-terminal disulfide linkages of human insulin-like growth factor-binding protein-6 (hIGFBP-6) and hIGFBP-1 are different as determined by mass spectrometry. J Biol Chem. 1999 May 21;274(21):14587-94. [Article]
  17. Bian Y, Song C, Cheng K, Dong M, Wang F, Huang J, Sun D, Wang L, Ye M, Zou H: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome. J Proteomics. 2014 Jan 16;96:253-62. doi: 10.1016/j.jprot.2013.11.014. Epub 2013 Nov 22. [Article]
  18. Tagliabracci VS, Wiley SE, Guo X, Kinch LN, Durrant E, Wen J, Xiao J, Cui J, Nguyen KB, Engel JL, Coon JJ, Grishin N, Pinna LA, Pagliarini DJ, Dixon JE: A Single Kinase Generates the Majority of the Secreted Phosphoproteome. Cell. 2015 Jun 18;161(7):1619-32. doi: 10.1016/j.cell.2015.05.028. [Article]
  19. Sala A, Capaldi S, Campagnoli M, Faggion B, Labo S, Perduca M, Romano A, Carrizo ME, Valli M, Visai L, Minchiotti L, Galliano M, Monaco HL: Structure and properties of the C-terminal domain of insulin-like growth factor-binding protein-1 isolated from human amniotic fluid. J Biol Chem. 2005 Aug 19;280(33):29812-9. Epub 2005 Jun 22. [Article]
  20. Sitar T, Popowicz GM, Siwanowicz I, Huber R, Holak TA: Structural basis for the inhibition of insulin-like growth factors by insulin-like growth factor-binding proteins. Proc Natl Acad Sci U S A. 2006 Aug 29;103(35):13028-33. Epub 2006 Aug 21. [Article]

Associated Data

Drug Relations
DrugDrug groupPharmacological action?TypeActionsDetails
Mecaserminapproved, investigationalunknowncarriercarrierDetails