P2Y purinoceptor 6
Details
- Name
- P2Y purinoceptor 6
- Kind
- protein
- Synonyms
- P2Y6
- Gene Name
- P2RY6
- UniProtKB Entry
- Q15077Swiss-Prot
- Organism
- Humans
- NCBI Taxonomy ID
- 9606
- Amino acid sequence
>lcl|BSEQ0013697|P2Y purinoceptor 6 MEWDNGTGQALGLPPTTCVYRENFKQLLLPPVYSAVLAAGLPLNICVITQICTSRRALTR TAVYTLNLALADLLYACSLPLLIYNYAQGDHWPFGDFACRLVRFLFYANLHGSILFLTCI SFQRYLGICHPLAPWHKRGGRRAAWLVCVAVWLAVTTQCLPTAIFAATGIQRNRTVCYDL SPPALATHYMPYGMALTVIGFLLPFAALLACYCLLACRLCRQDGPAEPVAQERRGKAARM AVVVAAAFAISFLPFHITKTAYLAVRSTPGVPCTVLEAFAAAYKGTRPFASANSVLDPIL FYFTQKKFRRRPHELLQKLTAKWQRQGR
- Number of residues
- 328
- Molecular Weight
- 36428.545
- Theoretical pI
- Not Available
- GO Classification
- FunctionsG protein-coupled ADP receptor activity / G protein-coupled receptor activity / G protein-coupled UDP receptor activity / G protein-coupled UTP receptor activityProcessescellular response to prostaglandin E stimulus / cellular response to purine-containing compound / cellular response to pyrimidine ribonucleotide / G protein-coupled receptor signaling pathway / phagocytosis / phospholipase C-activating G protein-coupled receptor signaling pathway / positive regulation of ERK1 and ERK2 cascade / positive regulation of inositol 1,4,5-trisphosphate-sensitive calcium-release channel activity / positive regulation of inositol trisphosphate biosynthetic process / positive regulation of smooth muscle cell migration / positive regulation of vascular associated smooth muscle cell proliferation / transepithelial chloride transportComponentsapical plasma membrane / basolateral plasma membrane / plasma membrane
- General Function
- Receptor for extracellular UDP > UTP > ATP. The activity of this receptor is mediated by G proteins which activate a phosphatidylinositol-calcium second messenger system
- Specific Function
- G protein-coupled ADP receptor activity
- Pfam Domain Function
- 7tm_1 (PF00001)
- Signal Regions
- Not Available
- Transmembrane Regions
- 28-48 63-83 102-122 145-165 195-215 237-257 281-303
- Cellular Location
- Cell membrane
- Gene sequence
- Not Available
- Chromosome Location
- 11
- Locus
- 11q13.4
- External Identifiers
Resource Link UniProtKB ID Q15077 UniProtKB Entry Name P2RY6_HUMAN GeneCard ID P2RY6 HGNC ID HGNC:8543 KEGG ID hsa:5031 IUPHAR/Guide To Pharmacology ID 326 NCBI Gene ID 5031 - General References
- Not Available
Associated Data
- Drug Relations
Drug Drug group Pharmacological action? Type Actions Details Adenosine disphosphate investigational yes target agonist Details Uridine 5'-triphosphate experimental, investigational yes target agonist Details