Interferon gamma-1b

Identification

Summary

Interferon gamma-1b is a form of recombinant human interferon used to treat infections associated with chronic granulomatous disease and to slow the progression of severe malignant osteopetrosis.

Brand Names
Actimmune
Generic Name
Interferon gamma-1b
DrugBank Accession Number
DB00033
Background

Human Interferon gamma-1b (140 residues), produced from E. coli. Production of Actimmune is achieved by fermentation of a genetically engineered Escherichia coli bacterium containing the DNA which encodes for the human protein. Purification of the product is achieved by conventional column chromatography. The sequence displayed is a cDNA sequence which codes for human interferon gamma, as described by Gray et. al. and not specifically interferon gamma 1b.

Type
Biotech
Groups
Approved, Investigational
Biologic Classification
Protein Based Therapies
Interferons
Protein Structure
Db00033
Protein Chemical Formula
C761H1206N214O225S6
Protein Average Weight
17145.6 Da
Sequences
>DB00033 sequence
CYCQDPYVKEAENLKKYFNAGHSDVADNGTLFLGILKNWKEESDRKIMQSQIVSFYFKLF
KNFKDDQSIQKSVETIKEDMNVKFFNSNKKKRDDFEKLTNYSVTDLNVQRKAIHELIQVM
AELSPAAKTGKRKRSQMLFRGRRASQ
Download FASTA Format
Synonyms
  • IFN-gamma 1b
  • IFN-gamma-1b
  • Interferon gamma 1-b
  • Interferon gamma-1b
  • Interferon gamma-1b, recombinant
  • Interferon gamma-2a

Pharmacology

Indication

Interferon gamma-1b is used for the treatment of Chronic granulomatous disease and Osteopetrosis.

Pharmacology
Reduce drug development failure rates
Build, train, & validate machine-learning models
with evidence-based and structured datasets.
See how
Build, train, & validate predictive machine-learning models with structured datasets.
See how
Associated Conditions
Contraindications & Blackbox Warnings
Contraindications
Avoid life-threatening adverse drug events
Improve clinical decision support with information on contraindications & blackbox warnings, population restrictions, harmful risks, & more.
Learn more
Avoid life-threatening adverse drug events & improve clinical decision support.
Learn more
Pharmacodynamics

IFN gamma stimulates expression of the immunoglobulin heavy chain C gamma 3 and C gamma 2a germline transcripts in B cells. Many components of the antigen presentation pathways are also up-regulated by interferon gamma. It is also a potent activator of macrophages, it has antiproliferative effects on transformed cells and it can potentiate the antiviral and antitumor effects of type I interferons. Interferon gamma may also help the body regulate the activity of fibroblasts. By directly blocking the multiplication of fibroblasts and inhibiting the production and action of TGF-b, a potent scar-inducing molecule, Interferon gamma-1b may prevent excessive scarring.

Mechanism of action

Binds directly to the type II interferon gamma receptor IFNGR1, leading to a complex of IFNGR1 and IFNGR2. This activates JAK1 and JAK2 kinases which form a STAT1 docking site. This leads to STAT1 phosphorylation, nuclear translocation and initiation of gene transcription of multiple immune-related genes.

TargetActionsOrganism
AInterferon gamma receptor 1
binder
Humans
AInterferon gamma receptor 2
binder
Humans
Absorption

Not Available

Volume of distribution

Not Available

Protein binding

Not Available

Metabolism
Not Available
Route of elimination

Not Available

Half-life

Not Available

Clearance

Not Available

Adverse Effects
Adverseeffects
Improve decision support & research outcomes
With structured adverse effects data, including: blackbox warnings, adverse reactions, warning & precautions, & incidence rates.
Learn more
Improve decision support & research outcomes with our structured adverse effects data.
Learn more
Toxicity

Not Available

Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
DrugInteraction
AbataceptThe risk or severity of adverse effects can be increased when Interferon gamma-1b is combined with Abatacept.
AbciximabThe risk or severity of bleeding can be increased when Abciximab is combined with Interferon gamma-1b.
AcenocoumarolThe metabolism of Acenocoumarol can be decreased when combined with Interferon gamma-1b.
AcetaminophenThe metabolism of Acetaminophen can be decreased when combined with Interferon gamma-1b.
Acetylsalicylic acidThe risk or severity of bleeding can be increased when Acetylsalicylic acid is combined with Interferon gamma-1b.
AcyclovirThe metabolism of Acyclovir can be decreased when combined with Interferon gamma-1b.
AdalimumabThe risk or severity of adverse effects can be increased when Interferon gamma-1b is combined with Adalimumab.
Adenovirus type 7 vaccine liveThe risk or severity of infection can be increased when Adenovirus type 7 vaccine live is combined with Interferon gamma-1b.
AgomelatineThe metabolism of Agomelatine can be decreased when combined with Interferon gamma-1b.
AlbendazoleThe metabolism of Albendazole can be decreased when combined with Interferon gamma-1b.
Interactions
Identify potential medication risks
Easily compare up to 40 drugs with our drug interaction checker.
Get severity rating, description, and management advice.
Learn more
Food Interactions
  • Avoid excessive or chronic alcohol consumption. Interferon gamma-1b may cause fatigue, drowsiness, and confusion. These effects may be exacerbated by alcohol consumption.

Products

Products2
Drug product information from 10+ global regions
Our datasets provide approved product information including:
dosage, form, labeller, route of administration, and marketing period.
Access now
Access drug product information from over 10 global regions.
Access now
International/Other Brands
Immukin
Brand Name Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing EndRegionImage
ActimmuneInjection, solution100 ug/0.5mLSubcutaneousInter Mune1999-02-252015-03-31US flag
ActimmuneInjection, solution100 ug/0.5mLSubcutaneousHznp Usa, Inc.2013-12-012018-01-17US flag
ActimmuneInjection, solution100 ug/0.5mLSubcutaneousHorizon Therapeutics USA, Inc.2013-12-01Not applicableUS flag

Categories

Drug Categories
Chemical TaxonomyProvided by Classyfire
Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available
Affected organisms
Not Available

Chemical Identifiers

UNII
21K6M2I7AG
CAS number
98059-61-1

References

Synthesis Reference

Irwin A. Braude, "Production of human IFN-gamma (immune) interferon." U.S. Patent US4376821, issued December, 1975.

US4376821
General References
  1. Kantoch M, Dobrowolska H, Jarzabek Z, Jankowski M, Sadowski W, Janicki P: [Distribution and characteristics of Poliovirus strains circulating in Poland in 1968-1972. Genetic variation of strains isolated in various secretion periods and clones isolated from vaccines]. Med Dosw Mikrobiol. 1975;27(4):353-63. [Article]
  2. Ormas P, Pompa G, Beretta C, Faustini R: [The effects of some polypeptides on the systemic blood pressure of sheep (author's transl)]. Folia Vet Lat. 1975 Jan-Mar;5(1):45-54. [Article]
  3. Selitrennikoff CP, Sonneborn DR: Alkaline phosphatase of Blastocladiella emersonii: partial purification and characterization. J Bacteriol. 1977 Apr;130(1):249-56. [Article]
  4. Gray PW, Goeddel DV: Structure of the human immune interferon gene. Nature. 1982 Aug 26;298(5877):859-63. [Article]
  5. Ealick SE, Cook WJ, Vijay-Kumar S, Carson M, Nagabhushan TL, Trotta PP, Bugg CE: Three-dimensional structure of recombinant human interferon-gamma. Science. 1991 May 3;252(5006):698-702. [Article]
  6. Ikeda H, Old LJ, Schreiber RD: The roles of IFN gamma in protection against tumor development and cancer immunoediting. Cytokine Growth Factor Rev. 2002 Apr;13(2):95-109. [Article]
  7. Chesler DA, Reiss CS: The role of IFN-gamma in immune responses to viral infections of the central nervous system. Cytokine Growth Factor Rev. 2002 Dec;13(6):441-54. [Article]
  8. Dessein A, Kouriba B, Eboumbou C, Dessein H, Argiro L, Marquet S, Elwali NE, Rodrigues V, Li Y, Doumbo O, Chevillard C: Interleukin-13 in the skin and interferon-gamma in the liver are key players in immune protection in human schistosomiasis. Immunol Rev. 2004 Oct;201:180-90. [Article]
  9. Joseph AM, Kumar M, Mitra D: Nef: "necessary and enforcing factor" in HIV infection. Curr HIV Res. 2005 Jan;3(1):87-94. [Article]
  10. Copeland KF: Modulation of HIV-1 transcription by cytokines and chemokines. Mini Rev Med Chem. 2005 Dec;5(12):1093-101. [Article]
  11. Schroder K, Hertzog PJ, Ravasi T, Hume DA: Interferon-gamma: an overview of signals, mechanisms and functions. J Leukoc Biol. 2004 Feb;75(2):163-89. Epub 2003 Oct 2. [Article]
UniProt
P01579
Genbank
X13274
PubChem Substance
46507194
RxNav
5882
ChEMBL
CHEMBL1201564
Therapeutic Targets Database
DAP001286
PharmGKB
PA164746386
Drugs.com
Drugs.com Drug Page
Wikipedia
Interferon_gamma
FDA label
Download (605 KB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
3CompletedTreatmentFriedreich's Ataxia3
3TerminatedDiagnosticOvarian Carcinoma / Primary Peritoneal Cancer1
3TerminatedTreatmentIdiopathic Pulmonary Fibrosis (IPF) / Lung Disorder / Pulmonary Fibrosis2
2Active Not RecruitingTreatmentMetastatic Myxoid Liposarcoma / Metastatic Round Cell Liposarcoma / Metastatic Synovial Sarcoma / Recurrent Mycosis Fungoides and Sezary Syndrome / Refractory Mycosis Fungoides and Sezary Syndrome / Stage IB Mycosis Fungoides and Sezary Syndrome AJCC v7 / Stage II Mycosis Fungoides and Sezary Syndrome AJCC v7 / Stage IIA Mycosis Fungoides and Sezary Syndrome AJCC v7 / Stage IIB Mycosis Fungoides and Sezary Syndrome AJCC v7 / Stage III Mycosis Fungoides and Sezary Syndrome AJCC v7 / Stage IIIA Mycosis Fungoides and Sezary Syndrome AJCC v7 / Stage IIIB Mycosis Fungoides and Sezary Syndrome AJCC v7 / Stage IV Mycosis Fungoides and Sezary Syndrome AJCC v7 / Stage IVA Mycosis Fungoides and Sezary Syndrome AJCC v7 / Stage IVB Mycosis Fungoides and Sezary Syndrome AJCC v7 / Unresectable Synovial Sarcoma1
2CompletedTreatmentAutosomal Dominant Osteopetrosis Type 21
2CompletedTreatmentChronic Hepatitis C Virus (HCV) Infection1
2CompletedTreatmentCirrhosis of the Liver / Fibrosis, Liver1
2CompletedTreatmentColorectal Carcinoma (CRC)1
2CompletedTreatmentFriedreich's Ataxia1
2CompletedTreatmentHuman Immunodeficiency Virus (HIV) Infections1

Pharmacoeconomics

Manufacturers
Not Available
Packagers
  • InterMune Inc.
Dosage Forms
FormRouteStrength
Injection, solutionSubcutaneous100 ug/0.5mL
Injection, solutionParenteral; Subcutaneous0.1 mg/0.5ml
Injection, solutionParenteral100 Mikrogramm/0.5ml
Prices
Unit descriptionCostUnit
Actimmune 2 million unit vial344.4USD vial
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)Region
US6936695No2005-08-302022-08-30US flag
US6936694No2005-08-302022-08-30US flag

Properties

State
Liquid
Experimental Properties
PropertyValueSource
melting point (°C)61 °CBeldarrain, A. et al., Biochemistry 38:7865-7873 (1999)
hydrophobicity-0.823Not Available
isoelectric point9.54Not Available

Targets

Drugtargets2
Build, predict & validate machine-learning models
Use our structured and evidence-based datasets to unlock new
insights and accelerate drug research.
Learn more
Use our structured and evidence-based datasets to unlock new insights and accelerate drug research.
Learn more
Kind
Protein
Organism
Humans
Pharmacological action
Yes
Actions
Binder
General Function
Interferon-gamma receptor activity
Specific Function
Receptor for interferon gamma. Two receptors bind one interferon gamma dimer.
Gene Name
IFNGR1
Uniprot ID
P15260
Uniprot Name
Interferon gamma receptor 1
Molecular Weight
54404.07 Da
References
  1. Matsuda A, Ebihara N, Kumagai N, Fukuda K, Ebe K, Hirano K, Sotozono C, Tei M, Hasegawa K, Shimizu M, Tamari M, Namba K, Ohno S, Mizuki N, Ikezawa Z, Shirakawa T, Hamuro J, Kinoshita S: Genetic polymorphisms in the promoter of the interferon gamma receptor 1 gene are associated with atopic cataracts. Invest Ophthalmol Vis Sci. 2007 Feb;48(2):583-9. [Article]
  2. Yao X, Chen ZQ, Gong JQ, Chen M, Li AS, Liu J: The interferon-gamma receptor gene polymorphisms (Val14Met and Gln64Arg) are not associated with systemic lupus erythematosus in Chinese patients. Arch Dermatol Res. 2007 Oct;299(8):367-71. Epub 2007 Jul 6. [Article]
  3. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [Article]
Kind
Protein
Organism
Humans
Pharmacological action
Yes
Actions
Binder
General Function
Interferon-gamma receptor activity
Specific Function
Part of the receptor for interferon gamma. Required for signal transduction. This accessory factor is an integral part of the IFN-gamma signal transduction pathway and is likely to interact with GA...
Gene Name
IFNGR2
Uniprot ID
P38484
Uniprot Name
Interferon gamma receptor 2
Molecular Weight
37805.97 Da
References
  1. Park-Min KH, Serbina NV, Yang W, Ma X, Krystal G, Neel BG, Nutt SL, Hu X, Ivashkiv LB: FcgammaRIII-dependent inhibition of interferon-gamma responses mediates suppressive effects of intravenous immune globulin. Immunity. 2007 Jan;26(1):67-78. [Article]
  2. Yao X, Chen ZQ, Gong JQ, Chen M, Li AS, Liu J: The interferon-gamma receptor gene polymorphisms (Val14Met and Gln64Arg) are not associated with systemic lupus erythematosus in Chinese patients. Arch Dermatol Res. 2007 Oct;299(8):367-71. Epub 2007 Jul 6. [Article]
  3. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [Article]

Enzymes

Kind
Protein
Organism
Humans
Pharmacological action
Unknown
Actions
Inhibitor
General Function
Oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen
Specific Function
Cytochromes P450 are a group of heme-thiolate monooxygenases. In liver microsomes, this enzyme is involved in an NADPH-dependent electron transport pathway. It oxidizes a variety of structurally un...
Gene Name
CYP1A2
Uniprot ID
P05177
Uniprot Name
Cytochrome P450 1A2
Molecular Weight
58293.76 Da
References
  1. Delaporte E, Renton KW: Cytochrome P4501A1 and cytochrome P4501A2 are downregulated at both transcriptional and post-transcriptional levels by conditions resulting in interferon-alpha/beta induction. Life Sci. 1997;60(10):787-96. doi: 10.1016/s0024-3205(97)00006-4. [Article]
  2. Donato MT, Guillen MI, Jover R, Castell JV, Gomez-Lechon MJ: Nitric oxide-mediated inhibition of cytochrome P450 by interferon-gamma in human hepatocytes. J Pharmacol Exp Ther. 1997 Apr;281(1):484-90. [Article]

Drug created on June 13, 2005 13:24 / Updated on August 07, 2021 00:17