Indium In-111 satumomab pendetide

Identification

Generic Name
Indium In-111 satumomab pendetide
DrugBank Accession Number
DB00057
Background

Tumor associated glycoprotein (TAG) 72 (B72.3) monoclonal antibody conjugated with Indium 111 for radioimaging colon tumors. Satumomab Pendetide (trade name: OncoScint®) is no longer commercially available.

Type
Biotech
Groups
Experimental, Withdrawn
Biologic Classification
Protein Based Therapies
Monoclonal antibody (mAb)
Protein Structure
Db00057
Protein Chemical Formula
C6268H9708N1666O1971S48
Protein Average Weight
141478.9 Da
Sequences
>Heavy chain 1 B72.3 (murine)
QVQLQQSDAELVKPGASVKISCKASGYTFTDHAIHWAKQKPEQGLEWIGYISPGNDDIKY
NEKFKGKATLTADKSSSTAYMQLNSLTSEDSAVYFCKRSYYGHWGQGTTLTVSSASTKGP
SVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLS
SVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVCPPCKCPAPNLLGGPSVFIFPPKIKDVL
MISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQ
DWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTD
FMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEG
LHNHHTTKSFSR
>Light chain 1 B72.3 (murine)
DIQMTQSPASLSVSVGETVTITCRASENIYSNLAWYQQKQGKSPQLLVYAATNLADGVPS
RFSGSGSGTQYSLKINSLQSEDFGSYYCQHFWGTPYTFGGGTRLEIKRADAAPTVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFN
>Heavy chain 2 B72.3 (murine)
QVQLQQSDAELVKPGASVKISCKASGYTFTDHAIHWAKQKPEQGLEWIGYISPGNDDIKY
NEKFKGKATLTADKSSSTAYMQLNSLTSEDSAVYFCKRSYYGHWGQGTTLTVSSASTKGP
SVFPLAPCSRSTSESTAALGCLVKDYFPEPVTVSWNSGALTSGVHTFPAVLQSSGLYSLS
SVVTVPSSSLGTKTYTCNVDHKPSNTKVDKRVCPPCKCPAPNLLGGPSVFIFPPKIKDVL
MISLSPIVTCVVVDVSEDDPDVQISWFVNNVEVHTAQTQTHREDYNSTLRVVSALPIQHQ
DWMSGKEFKCKVNNKDLPAPIERTISKPKGSVRAPQVYVLPPPEEEMTKKQVTLTCMVTD
FMPEDIYVEWTNNGKTELNYKNTEPVLDSDGSYFMYSKLRVEKKNWVERNSYSCSVVHEG
LHNHHTTKSFSR
>Light chain 2 B72.3 (murine)
DIQMTQSPASLSVSVGETVTITCRASENIYSNLAWYQQKQGKSPQLLVYAATNLADGVPS
RFSGSGSGTQYSLKINSLQSEDFGSYYCQHFWGTPYTFGGGTRLEIKRADAAPTVFIFPP
SDEQLKSGTASVVCLLNNFYPREAKVQWKVDNALQSGNSQESVTEQDSKDSTYSLSSTLT
LSKADYEKHKVYACEVTHQGLSSPVTKSFN
Download FASTA Format
Synonyms
  • Indium (111In) satumomab pendetide
  • Indium In 111 satumomab pendetide
  • Indium-111 satumomab pendetide
External IDs
  • CYT-099
  • CYT-103

Pharmacology

Indication

For diagnosis of extrahepatic malignant cancers

Pharmacology
Accelerate your drug discovery research with the industry’s only fully connected ADMET dataset, ideal for:
Machine Learning
Data Science
Drug Discovery
Accelerate your drug discovery research with our fully connected ADMET dataset
Learn more
Contraindications & Blackbox Warnings
Contraindications
Contraindications & Blackbox Warnings
With our commercial data, access important information on dangerous risks, contraindications, and adverse effects.
Learn more
Our Blackbox Warnings cover Risks, Contraindications, and Adverse Effects
Learn more
Pharmacodynamics

Binds to the tumor associated glycoprotein 72 antigen, which is a cell surface protein generally over-expressed in colorectal cancers. The radioactive Indium 111, which is covalently attached to the antibody, allows radiodiagnostic detection of TAG-72 expressing cells and tumors.

Mechanism of action

Satumomab Pendetide is a monoclonal antibody which is attached to the chelator pentetic acid (DTPA) linked to the tripeptide glycine (G) – L-tyrosine (Y) – L-lysine (K), which chelates Indium 111. Satumomab pendetide binds selectively to cell-surface TAG-72 expressed on colorectal tumors.

TargetActionsOrganism
ATumor-associated glycoprotein 72 (TAG-72)
other/unknown
Humans
Absorption

Not Available

Volume of distribution

Not Available

Protein binding

Not Available

Metabolism

Most likely removed by opsonization via the reticuloendothelial system or by human antimurine antibody production

Route of elimination

Not Available

Half-life

0.8 hours (mammalian reticulocytes, in vitro)

Clearance

Not Available

Adverse Effects
Medicalerrors
Reduce medical errors
and improve treatment outcomes with our comprehensive & structured data on drug adverse effects.
Learn more
Reduce medical errors & improve treatment outcomes with our adverse effects data
Learn more
Toxicity

Not Available

Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
DrugInteraction
AbciximabThe risk or severity of adverse effects can be increased when Abciximab is combined with Indium In-111 satumomab pendetide.
AdalimumabThe risk or severity of adverse effects can be increased when Adalimumab is combined with Indium In-111 satumomab pendetide.
AducanumabThe risk or severity of adverse effects can be increased when Indium In-111 satumomab pendetide is combined with Aducanumab.
AlemtuzumabThe risk or severity of adverse effects can be increased when Indium In-111 satumomab pendetide is combined with Alemtuzumab.
AlirocumabThe risk or severity of adverse effects can be increased when Indium In-111 satumomab pendetide is combined with Alirocumab.
AmivantamabThe risk or severity of adverse effects can be increased when Indium In-111 satumomab pendetide is combined with Amivantamab.
AnsuvimabThe risk or severity of adverse effects can be increased when Indium In-111 satumomab pendetide is combined with Ansuvimab.
Anthrax immune globulin humanThe risk or severity of adverse effects can be increased when Indium In-111 satumomab pendetide is combined with Anthrax immune globulin human.
Antilymphocyte immunoglobulin (horse)The risk or severity of adverse effects can be increased when Indium In-111 satumomab pendetide is combined with Antilymphocyte immunoglobulin (horse).
Antithymocyte immunoglobulin (rabbit)The risk or severity of adverse effects can be increased when Indium In-111 satumomab pendetide is combined with Antithymocyte immunoglobulin (rabbit).
Interactions
Improve patient outcomes
Build effective decision support tools with the industry’s most comprehensive drug-drug interaction checker.
Learn more
Food Interactions
Not Available

Products

Products
Comprehensive & structured drug product info
From application numbers to product codes, connect different identifiers through our commercial datasets.
Learn more
Easily connect various identifiers back to our datasets
Learn more
International/Other Brands
OncoScint (Cytogen Corp, Lonza Biologics)

Categories

ATC Codes
V09IB02 — Indium (111in) satumomab pendetide
Drug Categories
Chemical TaxonomyProvided by Classyfire
Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available
Affected organisms
  • Humans and other mammals

Chemical Identifiers

UNII
7V9926378A
CAS number
138955-27-8

References

General References
  1. Artiko V, Obradovic V, Davidovic B, Petrovic N, Petrovic M, Krivokapic Z, Kecmanovic D, Pesko P, Djukic V, Milosavljevic T, Adanja G, Vlajkovic M: Radioimmunodetection of colorectal carcinoma. Hepatogastroenterology. 2003 Jul-Aug;50(52):1029-31. [Article]
  2. Bohdiewicz PJ: Indium-111 satumomab pendetide: the first FDA-approved monoclonal antibody for tumor imaging. J Nucl Med Technol. 1998 Sep;26(3):155-63; quiz 170-1. [Article]
PubChem Substance
46505873
ChEMBL
CHEMBL1743091
Therapeutic Targets Database
DAP001299
PharmGKB
PA164745371
MSDS
Download (275 KB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount

Pharmacoeconomics

Manufacturers
Not Available
Packagers
  • EUSA Pharma Inc.
Dosage Forms
Not Available
Prices
Not Available
Patents
Not Available

Properties

State
Liquid
Experimental Properties
PropertyValueSource
melting point (°C)61 °C (FAB fragment), 71 °C (whole mAb)Vermeer, A.W.P. & Norde, W., Biophys. J. 78:394-404 (2000)
hydrophobicity-0.427Not Available
isoelectric point7.02Not Available

Targets

Drugtargets
Accelerate your drug discovery research
with our fully connected ADMET & drug target dataset.
Learn more
Accelerate your drug discovery research with our ADMET & drug target dataset
Learn more
1. Tumor-associated glycoprotein 72 (TAG-72)
Kind
Group
Organism
Humans
Pharmacological action
Yes
Actions
Other/unknown
References
  1. Overington JP, Al-Lazikani B, Hopkins AL: How many drug targets are there? Nat Rev Drug Discov. 2006 Dec;5(12):993-6. [Article]
  2. Imming P, Sinning C, Meyer A: Drugs, their targets and the nature and number of drug targets. Nat Rev Drug Discov. 2006 Oct;5(10):821-34. [Article]
  3. Muxi A, Pons F, Vidal-Sicart S, Setoain FJ, Herranz R, Novell F, Fernandez RM, Trias M, Setoain J: Radioimmunoguided surgery of colorectal carcinoma with an 111In-labelled anti-TAG72 monoclonal antibody. Nucl Med Commun. 1999 Feb;20(2):123-30. [Article]

Drug created on June 13, 2005 13:24 / Updated on April 03, 2021 09:33