Hyaluronidase (ovine)

Identification

Summary

Hyaluronidase (ovine) is a purified form of sheep hyaluronidase enzyme used as an adjunct in subcutaneous rehydration therapy and to increase absorption of other drugs and radiopaque imaging agents.

Brand Names
Vitrase
Generic Name
Hyaluronidase (ovine)
DrugBank Accession Number
DB00070
Background

Highly purified sheep hyaluronidase for administration by injection into the vitreous of the eye.

Type
Biotech
Groups
Approved, Investigational
Biologic Classification
Protein Based Therapies
Other protein based therapies
Protein Structure
Db00070
Protein Chemical Formula
C2455H3775N617O704S21
Protein Average Weight
53870.9 Da
Sequences
> Hyaluronidase Sequence
MWTGLGPAVTLALVLVVAWATELKPTAPPIFTGRPFVVAWDVPTQDCGPRHKMPLDPKDM
KAFDVQASPNEGFVNQNITIFYRDRLGMYPHFNSVGGSVHGGVPQNGSLWVHLEMLKGHV
EHYIRTQEPAGLAVIDWEDWRPVWVRNWQDKDVYRRLSRQLVASHHPDWPPERIVKEAQY
EFEFAARQFMLETLRFVKAFRPRHLWGFYLFPDCYNHDYVQNWETYTGRCPDVEVSRNDQ
LSWLWAESTALFPSVYLEETLASSTHGRNFVSFRVQEALRVADVHHANHALPVYVFTRPT
YSRGLTGLSEMDLISTIGESAALGAAGVILWGDAGFTTSNETCRRLKDYLTRSLVPYVVN
VSWAAQYCSWAQCHGHGRCVRRDPNAHTFLHLSASSFRLVPSHAPDEPRLRPEGELSWAD
RNHLQTHFRCQCYLGWGGEQCQWDRRRAAGGASGAWAGFHLTGLLAVAVLAFTWTS
Download FASTA Format
Synonyms
  • Hyaluronidase (glycoprotein, sheep testis isoenzyme)
  • Hyaluronidase (ovine)
  • Hyaluronidase (sheep testis isoenzyme)
  • Hyaluronidase, ovine
  • Ovine hyaluronidase
External IDs
  • HYO-6A
  • HYO6A

Pharmacology

Indication

For increase of absorption and distribution of other injected drugs and for rehydration.

Pharmacology
Reduce drug development failure rates
Build, train, & validate machine-learning models
with evidence-based and structured datasets.
See how
Build, train, & validate predictive machine-learning models with structured datasets.
See how
Associated Conditions
Associated Therapies
Contraindications & Blackbox Warnings
Contraindications
Avoid life-threatening adverse drug events
Improve clinical decision support with information on contraindications & blackbox warnings, population restrictions, harmful risks, & more.
Learn more
Avoid life-threatening adverse drug events & improve clinical decision support.
Learn more
Pharmacodynamics

Hyaluronidase hydrolyzes hyaluronic acid and increase diffusion of injected drugs, thus facilitating their absorption. Hyaluronidase is used for enhancing absorption and distribution of other injected drugs.

Mechanism of action

Hyaluronidase is a spreading or diffusing substance. It increase the permeability of connective tissue through the hydrolysis of hyaluronic acid. Hyaluronidase hydrolyzes hyaluronic acid by splitting the glucosaminidic bond between C1 of the glucosamine moiety and C4 of glucuronic acid. This temporarily decreases the viscosity of the cellular cement and increases diffusion of injected fluids or of localized transudates or exudates, thus facilitating their absorption.

TargetActionsOrganism
AHyaluronan
other
Humans
UTransforming growth factor beta-1
inhibitor
Humans
Absorption

Not Available

Volume of distribution

Not Available

Protein binding

Not Available

Metabolism
Not Available
Route of elimination

Not Available

Half-life

Not Available

Clearance

Not Available

Adverse Effects
Adverseeffects
Improve decision support & research outcomes
With structured adverse effects data, including: blackbox warnings, adverse reactions, warning & precautions, & incidence rates.
Learn more
Improve decision support & research outcomes with our structured adverse effects data.
Learn more
Toxicity

Not Available

Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
DrugInteraction
1,2-BenzodiazepineThe therapeutic efficacy of 1,2-Benzodiazepine can be decreased when used in combination with Hyaluronidase (ovine).
Acetylsalicylic acidThe therapeutic efficacy of Hyaluronidase (ovine) can be decreased when used in combination with Acetylsalicylic acid.
AmitriptylineThe therapeutic efficacy of Hyaluronidase (ovine) can be decreased when used in combination with Amitriptyline.
AntazolineThe therapeutic efficacy of Hyaluronidase (ovine) can be decreased when used in combination with Antazoline.
AripiprazoleThe therapeutic efficacy of Hyaluronidase (ovine) can be decreased when used in combination with Aripiprazole.
Aripiprazole lauroxilThe therapeutic efficacy of Hyaluronidase (ovine) can be decreased when used in combination with Aripiprazole lauroxil.
ArticaineHyaluronidase (ovine) can cause an increase in the absorption of Articaine resulting in an increased serum concentration and potentially a worsening of adverse effects.
AzelastineThe therapeutic efficacy of Hyaluronidase (ovine) can be decreased when used in combination with Azelastine.
BenzatropineThe therapeutic efficacy of Hyaluronidase (ovine) can be decreased when used in combination with Benzatropine.
BenzocaineHyaluronidase (ovine) can cause an increase in the absorption of Benzocaine resulting in an increased serum concentration and potentially a worsening of adverse effects.
Interactions
Identify potential medication risks
Easily compare up to 40 drugs with our drug interaction checker.
Get severity rating, description, and management advice.
Learn more
Food Interactions
No interactions found.

Products

Products2
Drug product information from 10+ global regions
Our datasets provide approved product information including:
dosage, form, labeller, route of administration, and marketing period.
Access now
Access drug product information from over 10 global regions.
Access now
International/Other Brands
Diffusin / Enzodase / Hyazyme / Wydase
Brand Name Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing EndRegionImage
VitraseInjection, powder, lyophilized, for solution6200 [USP'U]/5mLSubcutaneousISTA PHARMACUTICALS, INC2004-07-012009-09-30US flag
VitraseInjection, solution200 [USP'U]/1mLSubcutaneousISTA Pharmaceuticals, Inc.2005-02-012018-06-07US flag
VitraseInjection, solution200 [USP'U]/1mLSubcutaneousBausch & Lomb Incorporated2005-02-01Not applicableUS flag

Categories

Drug Categories
Chemical TaxonomyProvided by Classyfire
Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available
Affected organisms
  • Humans and other mammals

Chemical Identifiers

UNII
64R4OHP8T0
CAS number
488712-31-8

References

Synthesis Reference

Yasuhiro Mima, Masaaki Yamada, "Preparation of human placental hyaluronidase." U.S. Patent US3945889, issued October, 1957.

US3945889
General References
  1. Csoka AB, Scherer SW, Stern R: Expression analysis of six paralogous human hyaluronidase genes clustered on chromosomes 3p21 and 7q31. Genomics. 1999 Sep 15;60(3):356-61. [Article]
UniProt
P38567
Genbank
L13781
PubChem Substance
46505087
RxNav
486164
ChEMBL
CHEMBL1201636
PharmGKB
PA164745713
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Hyaluronidase
FDA label
Download (42.5 KB)
MSDS
Download (72.5 KB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
4CompletedTreatmentPain1
3CompletedTreatmentDiabetic Retinopathy (DR) / Vitreous Hemorrhage2
3CompletedTreatmentPain1
2CompletedTreatmentDiabetic Retinopathy (DR) / Vitreous Detachment1
1CompletedNot AvailableDrug hypersensitivity reaction1
1CompletedScreeningDrug hypersensitivity reaction1

Pharmacoeconomics

Manufacturers
  • Amphastar pharmaceutical inc
  • Primapharm inc
  • Ista pharmaceuticals
  • Baxter healthcare corp anesthesia and critical care
Packagers
  • Akorn Inc.
  • Amphastar Pharmaceuticals
  • Bausch & Lomb Inc.
  • Baxter International Inc.
  • Cardinal Health
  • Halozyme Therapeutics Inc.
  • ISTA Pharmaceuticals
  • Oso Biopharmaceuticals Manufacturing LLC
  • Primapharm Inc.
  • Professional Co.
Dosage Forms
FormRouteStrength
Injection, powder, lyophilized, for solutionSubcutaneous6200 [USP'U]/5mL
Injection, solutionSubcutaneous200 [USP'U]/1mL
Prices
Unit descriptionCostUnit
Vitrasert 4.5 mg implant19200.0USD implant
Vitrase 6200 unit vial967.2USD vial
Hyaluronidase powder900.0USD g
Hylenex 150 unit/ml vial108.0USD ml
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Not Available

Properties

State
Liquid
Experimental Properties
PropertyValueSource
hydrophobicity-0.117Not Available
isoelectric point5.73Not Available

Targets

Drugtargets2
Build, predict & validate machine-learning models
Use our structured and evidence-based datasets to unlock new
insights and accelerate drug research.
Learn more
Use our structured and evidence-based datasets to unlock new insights and accelerate drug research.
Learn more
Kind
Small molecule
Organism
Humans
Pharmacological action
Yes
Actions
Other
Kind
Protein
Organism
Humans
Pharmacological action
Unknown
Actions
Inhibitor
General Function
Type iii transforming growth factor beta receptor binding
Specific Function
Multifunctional protein that controls proliferation, differentiation and other functions in many cell types. Many cells synthesize TGFB1 and have specific receptors for it. It positively and negati...
Gene Name
TGFB1
Uniprot ID
P01137
Uniprot Name
Transforming growth factor beta-1
Molecular Weight
44340.685 Da
References
  1. Chang NS: Hyaluronidase activation of c-Jun N-terminal kinase is necessary for protection of L929 fibrosarcoma cells from staurosporine-mediated cell death. Biochem Biophys Res Commun. 2001 May 4;283(2):278-86. [Article]
  2. Locci P, Marinucci L, Lilli C, Martinese D, Becchetti E: Transforming growth factor beta 1-hyaluronic acid interaction. Cell Tissue Res. 1995 Aug;281(2):317-24. [Article]
  3. Chang NS: Hyaluronidase enhancement of TNF-mediated cell death is reversed by TGF-beta 1. Am J Physiol. 1997 Dec;273(6 Pt 1):C1987-94. [Article]
  4. Chang NS: Transforming growth factor-beta protection of cancer cells against tumor necrosis factor cytotoxicity is counteracted by hyaluronidase (review). Int J Mol Med. 1998 Dec;2(6):653-9. [Article]

Carriers

Kind
Protein
Organism
Humans
Pharmacological action
Unknown
Actions
Inhibitor
General Function
Toxic substance binding
Specific Function
Serum albumin, the main protein of plasma, has a good binding capacity for water, Ca(2+), Na(+), K(+), fatty acids, hormones, bilirubin and drugs. Its main function is the regulation of the colloid...
Gene Name
ALB
Uniprot ID
P02768
Uniprot Name
Serum albumin
Molecular Weight
69365.94 Da
References
  1. Maingonnat C, Victor R, Bertrand P, Courel MN, Maunoury R, Delpech B: Activation and inhibition of human cancer cell hyaluronidase by proteins. Anal Biochem. 1999 Mar 1;268(1):30-4. [Article]
  2. Parameswaran S, Brown LV, Ibbott GS, Lai-Fook SJ: Effect of concentration and hyaluronidase on albumin diffusion across rabbit mesentery. Microcirculation. 1999 Jun;6(2):117-26. [Article]

Drug created on June 13, 2005 13:24 / Updated on July 03, 2021 08:55