Hyaluronidase (ovine)

Identification

Name
Hyaluronidase (ovine)
Accession Number
DB00070
Description

Highly purified sheep hyaluronidase for administration by injection into the vitreous of the eye.

Type
Biotech
Groups
Approved, Investigational
Biologic Classification
Protein Based Therapies
Other protein based therapies
Protein Structure
Db00070
Protein Chemical Formula
C2455H3775N617O704S21
Protein Average Weight
53870.9 Da
Sequences
> Hyaluronidase Sequence
MWTGLGPAVTLALVLVVAWATELKPTAPPIFTGRPFVVAWDVPTQDCGPRHKMPLDPKDM
KAFDVQASPNEGFVNQNITIFYRDRLGMYPHFNSVGGSVHGGVPQNGSLWVHLEMLKGHV
EHYIRTQEPAGLAVIDWEDWRPVWVRNWQDKDVYRRLSRQLVASHHPDWPPERIVKEAQY
EFEFAARQFMLETLRFVKAFRPRHLWGFYLFPDCYNHDYVQNWETYTGRCPDVEVSRNDQ
LSWLWAESTALFPSVYLEETLASSTHGRNFVSFRVQEALRVADVHHANHALPVYVFTRPT
YSRGLTGLSEMDLISTIGESAALGAAGVILWGDAGFTTSNETCRRLKDYLTRSLVPYVVN
VSWAAQYCSWAQCHGHGRCVRRDPNAHTFLHLSASSFRLVPSHAPDEPRLRPEGELSWAD
RNHLQTHFRCQCYLGWGGEQCQWDRRRAAGGASGAWAGFHLTGLLAVAVLAFTWTS
Download FASTA Format
Synonyms
  • Hyaluronidase (glycoprotein, sheep testis isoenzyme)
  • Hyaluronidase (ovine)
  • Hyaluronidase (sheep testis isoenzyme)
  • Hyaluronidase, ovine
  • Ovine hyaluronidase
External IDs
  • HYO-6A
  • HYO6A

Pharmacology

Indication

For increase of absorption and distribution of other injected drugs and for rehydration.

Associated Conditions
Associated Therapies
Contraindications & Blackbox Warnings
Learn about our commercial Contraindications & Blackbox Warnings data.
Learn More
Pharmacodynamics

Hyaluronidase hydrolyzes hyaluronic acid and increase diffusion of injected drugs, thus facilitating their absorption. Hyaluronidase is used for enhancing absorption and distribution of other injected drugs.

Mechanism of action

Hyaluronidase is a spreading or diffusing substance. It increase the permeability of connective tissue through the hydrolysis of hyaluronic acid. Hyaluronidase hydrolyzes hyaluronic acid by splitting the glucosaminidic bond between C1 of the glucosamine moiety and C4 of glucuronic acid. This temporarily decreases the viscosity of the cellular cement and increases diffusion of injected fluids or of localized transudates or exudates, thus facilitating their absorption.

TargetActionsOrganism
AHyaluronan
other
Humans
UTransforming growth factor beta-1
inhibitor
Humans
Absorption
Not Available
Volume of distribution
Not Available
Protein binding
Not Available
Metabolism
Not Available
Route of elimination
Not Available
Half-life
Not Available
Clearance
Not Available
Adverse Effects
Learn about our commercial Adverse Effects data.
Learn More
Toxicity
Not Available
Affected organisms
  • Humans and other mammals
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
DrugInteraction
Acetylsalicylic acidThe therapeutic efficacy of Hyaluronidase (ovine) can be decreased when used in combination with Acetylsalicylic acid.
AmitriptylineThe therapeutic efficacy of Hyaluronidase (ovine) can be decreased when used in combination with Amitriptyline.
AripiprazoleThe therapeutic efficacy of Hyaluronidase (ovine) can be decreased when used in combination with Aripiprazole.
Aripiprazole lauroxilThe therapeutic efficacy of Hyaluronidase (ovine) can be decreased when used in combination with Aripiprazole lauroxil.
ArticaineHyaluronidase (ovine) can cause an increase in the absorption of Articaine resulting in an increased serum concentration and potentially a worsening of adverse effects.
AzelastineThe therapeutic efficacy of Hyaluronidase (ovine) can be decreased when used in combination with Azelastine.
BenzatropineThe therapeutic efficacy of Hyaluronidase (ovine) can be decreased when used in combination with Benzatropine.
BenzocaineHyaluronidase (ovine) can cause an increase in the absorption of Benzocaine resulting in an increased serum concentration and potentially a worsening of adverse effects.
BenzodiazepineThe therapeutic efficacy of Benzodiazepine can be decreased when used in combination with Hyaluronidase (ovine).
Benzyl alcoholHyaluronidase (ovine) can cause an increase in the absorption of Benzyl alcohol resulting in an increased serum concentration and potentially a worsening of adverse effects.
Additional Data Available
  • Extended Description
    Extended Description

    Extended description of the mechanism of action and particular properties of each drug interaction.

    Learn more
  • Severity
    Severity

    A severity rating for each drug interaction, from minor to major.

    Learn more
  • Evidence Level
    Evidence Level

    A rating for the strength of the evidence supporting each drug interaction.

    Learn more
  • Action
    Action

    An effect category for each drug interaction. Know how this interaction affects the subject drug.

    Learn more
Food Interactions
Not Available

Products

International/Other Brands
Diffusin / Enzodase / Hyazyme / Wydase
Brand Name Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing EndRegionImage
VitraseInjection, solution200 [USP'U]/1mLSubcutaneousISTA Pharmaceuticals, Inc.2005-02-012018-06-07US flag
VitraseInjection, solution200 [USP'U]/1mLSubcutaneousBausch & Lomb Incorporated2005-02-01Not applicableUS flag
VitraseInjection, powder, lyophilized, for solution6200 [USP'U]/5mLSubcutaneousISTA PHARMACUTICALS, INC2004-07-012009-09-30US flag
Additional Data Available
  • Application Number
    Application Number

    A unique ID assigned by the FDA when a product is submitted for approval by the labeller.

    Learn more
  • Product Code
    Product Code

    A governmentally-recognized ID which uniquely identifies the product within its regulatory market.

    Learn more

Categories

Drug Categories
Chemical TaxonomyProvided by Classyfire
Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Chemical Identifiers

UNII
64R4OHP8T0
CAS number
488712-31-8

References

Synthesis Reference

Yasuhiro Mima, Masaaki Yamada, "Preparation of human placental hyaluronidase." U.S. Patent US3945889, issued October, 1957.

US3945889
General References
  1. Csoka AB, Scherer SW, Stern R: Expression analysis of six paralogous human hyaluronidase genes clustered on chromosomes 3p21 and 7q31. Genomics. 1999 Sep 15;60(3):356-61. [PubMed:10493834]
UniProt
P38567
Genbank
L13781
PubChem Substance
46505087
RxNav
486164
ChEMBL
CHEMBL1201636
PharmGKB
PA164745713
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Hyaluronidase
FDA label
Download (42.5 KB)
MSDS
Download (72.5 KB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
4CompletedTreatmentPain1
3CompletedTreatmentDiabetic Retinopathy (DR) / Vitreous Hemorrhage2
3CompletedTreatmentPain1
2CompletedTreatmentDiabetic Retinopathy (DR) / Vitreous Detachment1
1CompletedNot AvailableDrug hypersensitivity reaction1
1CompletedScreeningDrug hypersensitivity reaction1

Pharmacoeconomics

Manufacturers
  • Amphastar pharmaceutical inc
  • Primapharm inc
  • Ista pharmaceuticals
  • Baxter healthcare corp anesthesia and critical care
Packagers
  • Akorn Inc.
  • Amphastar Pharmaceuticals
  • Bausch & Lomb Inc.
  • Baxter International Inc.
  • Cardinal Health
  • Halozyme Therapeutics Inc.
  • ISTA Pharmaceuticals
  • Oso Biopharmaceuticals Manufacturing LLC
  • Primapharm Inc.
  • Professional Co.
Dosage Forms
FormRouteStrength
Injection, powder, lyophilized, for solutionSubcutaneous6200 [USP'U]/5mL
Injection, solutionSubcutaneous200 [USP'U]/1mL
Prices
Unit descriptionCostUnit
Vitrasert 4.5 mg implant19200.0USD implant
Vitrase 6200 unit vial967.2USD vial
Hyaluronidase powder900.0USD g
Hylenex 150 unit/ml vial108.0USD ml
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Not Available

Properties

State
Liquid
Experimental Properties
PropertyValueSource
hydrophobicity-0.117Not Available
isoelectric point5.73Not Available

Targets

Kind
Small molecule
Organism
Humans
Pharmacological action
Yes
Actions
Other
Kind
Protein
Organism
Humans
Pharmacological action
Unknown
Actions
Inhibitor
General Function
Type iii transforming growth factor beta receptor binding
Specific Function
Multifunctional protein that controls proliferation, differentiation and other functions in many cell types. Many cells synthesize TGFB1 and have specific receptors for it. It positively and negati...
Gene Name
TGFB1
Uniprot ID
P01137
Uniprot Name
Transforming growth factor beta-1
Molecular Weight
44340.685 Da
References
  1. Chang NS: Hyaluronidase activation of c-Jun N-terminal kinase is necessary for protection of L929 fibrosarcoma cells from staurosporine-mediated cell death. Biochem Biophys Res Commun. 2001 May 4;283(2):278-86. [PubMed:11327694]
  2. Locci P, Marinucci L, Lilli C, Martinese D, Becchetti E: Transforming growth factor beta 1-hyaluronic acid interaction. Cell Tissue Res. 1995 Aug;281(2):317-24. [PubMed:7648625]
  3. Chang NS: Hyaluronidase enhancement of TNF-mediated cell death is reversed by TGF-beta 1. Am J Physiol. 1997 Dec;273(6 Pt 1):C1987-94. [PubMed:9435505]
  4. Chang NS: Transforming growth factor-beta protection of cancer cells against tumor necrosis factor cytotoxicity is counteracted by hyaluronidase (review). Int J Mol Med. 1998 Dec;2(6):653-9. [PubMed:9850732]

Carriers

Kind
Protein
Organism
Humans
Pharmacological action
Unknown
Actions
Inhibitor
General Function
Toxic substance binding
Specific Function
Serum albumin, the main protein of plasma, has a good binding capacity for water, Ca(2+), Na(+), K(+), fatty acids, hormones, bilirubin and drugs. Its main function is the regulation of the colloid...
Gene Name
ALB
Uniprot ID
P02768
Uniprot Name
Serum albumin
Molecular Weight
69365.94 Da
References
  1. Maingonnat C, Victor R, Bertrand P, Courel MN, Maunoury R, Delpech B: Activation and inhibition of human cancer cell hyaluronidase by proteins. Anal Biochem. 1999 Mar 1;268(1):30-4. [PubMed:10036158]
  2. Parameswaran S, Brown LV, Ibbott GS, Lai-Fook SJ: Effect of concentration and hyaluronidase on albumin diffusion across rabbit mesentery. Microcirculation. 1999 Jun;6(2):117-26. [PubMed:10466114]

Drug created on June 13, 2005 07:24 / Updated on September 03, 2020 18:59

Logo pink
Are you a
new drug developer?
Contact us to learn more about our customized products and solutions.
Logo pink
Stay in the know!
As part of our commitment to providing the most up-to-date drug information, we will be releasing #DrugBankUpdates with our newly added curated drug pages.
#DrugBankUpdates