Choriogonadotropin alfa

Identification

Name
Choriogonadotropin alfa
Accession Number
DB00097
Description

Recombinant human chorionic gonadotropin with 2 subunits, alpha = 92 residues, beta = 145 residues, each with N-and O-linked carbohydrate moieties linked to ASN-52 and ASN-78 (on alpha subunit) and ASN-13, ASN-30, SER-121, SER-127, SER-132 and SER-138 (on beta subunit). The primary structure of the alpha-chain of r-hCG is identical to that of the alpha-chain of hCG, FSH and LH.

Type
Biotech
Groups
Approved
Biologic Classification
Protein Based Therapies
Hormones
Protein Structure
Db00097
Protein Chemical Formula
C1105H1770N318O336S26
Protein Average Weight
25719.7 Da
Sequences
>Alpha chain
APDVQDCPECTLQENPFFSQPGAPILQCMGCCFSRAYPTPLRSKKTMLVQKNVTSESTCC
VAKSYNRVTVMGGFKVENHTACHCSTCYYHKS
>Beta chain
SKEPLRPRCRPINATLAVEKEGCPVCITVNTTICAGYCPTMTRVLQGVLPALPQVVCNYR
DVRFESIRLPGCPRGVNPVVSYAVALSCQCALCRRSTTDCGGPKDHPLTCDDPRFQDSSS
SKAPPPSLPSPSRLPGPSDTPILPQ
Download FASTA Format
Synonyms
  • Choriogonadotropin alpha
  • Chorionic gonadotropin (recombinant)

Pharmacology

Indication

For the treatment of female infertility

Associated Therapies
Contraindications & Blackbox Warnings
Learn about our commercial Contraindications & Blackbox Warnings data.
Learn More
Pharmacodynamics

Choriogonadotropin alfa is used to treat female infertility, Choriogonadotropin alfa stimulates late follicular maturation and resumption of oocyte meiosis, and initiates rupture of the pre-ovulatory ovarian follicle. Ovidrel is an analogue of Luteinizing Hormone (LH) and binds to the LH/hCG receptor of the granulosa and theca cells of the ovary to effect these changes in the absence of an endogenous LH surge.

Mechanism of action

Choriogonadotropin alfa binds to the Follicle stimulating hormone receptor which results in ovulation in the absence of sufficient endogenous Luteinizing hormone.

TargetActionsOrganism
ALutropin-choriogonadotropic hormone receptorNot AvailableHumans
AFollicle-stimulating hormone receptor
binder
Humans
Absorption

The mean absolute bioavailability following a single subcutaneous injection to healthy female volunteers is about 40%.

Volume of distribution
  • 5.9 ± 1.0 L
Protein binding
Not Available
Metabolism
Not Available
Route of elimination

One-tenth of the dose is excreted in the urine.

Half-life

The mean terminal half-life is about 29 ± 6 hours (initial half-life is 4.5 ± 0.5 hours).

Clearance
  • 0.29 +/- 0.04 L/h [healthy down-regulated females]
Adverse Effects
Learn about our commercial Adverse Effects data.
Learn More
Toxicity
Not Available
Affected organisms
  • Humans and other mammals
Pathways
Not Available
Pharmacogenomic Effects/ADRs
Not Available

Interactions

Drug Interactions
This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.
Not Available
Food Interactions
Not Available

Products

International/Other Brands
Profasi (Serono S.A.)
Brand Name Prescription Products
NameDosageStrengthRouteLabellerMarketing StartMarketing EndRegionImage
Chorionic Gonadotropin10000 [USP'U]/10mLIntramuscularFresenius Kabi USA, LLC2011-04-21Not applicableUS flag
Chorionic GonadotropinKit10000 [USP'U]/10mLIntramuscularPhysicians Total Care, Inc.2007-07-132008-06-30US flag
Chorionic GonadotropinKit10000 [USP'U]/10mLIntramuscularAPP Pharmaceuticals, LLC2011-04-212011-04-20US flag
OvidrelSolution250 mcgSubcutaneousEmd Serono, A Division Of Emd Inc., Canada2004-12-20Not applicableCanada flag
OvidrelInjection, solution250 ug/0.5mLSubcutaneousEMD Serono, Inc.2003-10-06Not applicableUS flag
OvidrelSolution250 mcgSubcutaneousEmd Serono, A Division Of Emd Inc., Canada2013-05-28Not applicableCanada flag
OvitrelleInjection, solution250 micrograms/0.5mlSubcutaneousMerck Serono Europe Limited2001-02-02Not applicableEU flag
OvitrelleInjection, solution250 microgramsSubcutaneousMerck Serono Europe Limited2001-02-02Not applicableEU flag
PregnylKit10000 [USP'U]/10mLIntramuscularPhysicians Total Care, Inc.2010-08-17Not applicableUS flag
Pregnyl10000 [USP'U]/10mLIntramuscularOrganon USA Inc.1976-10-20Not applicableUS flag
Additional Data Available
  • Application Number
    Application Number

    A unique ID assigned by the FDA when a product is submitted for approval by the labeller.

    Learn more
  • Product Code
    Product Code

    A governmentally-recognized ID which uniquely identifies the product within its regulatory market.

    Learn more

Categories

ATC Codes
G03GA08 — Choriogonadotropin alfa
Drug Categories
Chemical TaxonomyProvided by Classyfire
Description
Not Available
Kingdom
Organic Compounds
Super Class
Organic Acids
Class
Carboxylic Acids and Derivatives
Sub Class
Amino Acids, Peptides, and Analogues
Direct Parent
Peptides
Alternative Parents
Not Available
Substituents
Not Available
Molecular Framework
Not Available
External Descriptors
Not Available

Chemical Identifiers

UNII
6413W06WR3
CAS number
177073-44-8

References

General References
  1. Kayisli UA, Selam B, Guzeloglu-Kayisli O, Demir R, Arici A: Human chorionic gonadotropin contributes to maternal immunotolerance and endometrial apoptosis by regulating Fas-Fas ligand system. J Immunol. 2003 Sep 1;171(5):2305-13. [PubMed:12928375]
  2. Askling J, Erlandsson G, Kaijser M, Akre O, Ekbom A: Sickness in pregnancy and sex of child. Lancet. 1999 Dec 11;354(9195):2053. [PubMed:10636378]
UniProt
P01233
Genbank
J00117
PubChem Substance
46506863
RxNav
283550
ChEMBL
CHEMBL1201464
Therapeutic Targets Database
DAP001030
PharmGKB
PA164783947
RxList
RxList Drug Page
Drugs.com
Drugs.com Drug Page
Wikipedia
Human_chorionic_gonadotropin
AHFS Codes
  • 68:18.00 — Gonadotropins and Antigonadotropins
FDA label
Download (97.1 KB)

Clinical Trials

Clinical Trials
PhaseStatusPurposeConditionsCount
4CompletedPreventionBRCA1 Mutations / BRCA2 Mutation / HCG1
4CompletedTreatmentInfertile Women Undergoing Assisted Reproductive Technology (ART)1
4CompletedTreatmentInfertility2
4CompletedTreatmentInfertility / Progesterone Levels1
4TerminatedTreatmentAssisted Reproductive Technology therapy1
4Unknown StatusTreatmentEmbryo Transfer / Luteal Support1
4Unknown StatusTreatmentInfertility1
3CompletedDiagnosticPolycystic Ovarian Syndrome1
3CompletedDiagnosticPolycystic Ovaries Syndrome1
3CompletedTreatmentAssisted Reproductive Techniques / Reproductive Technology, Assisted1

Pharmacoeconomics

Manufacturers
  • Emd serono inc
  • Ferring pharmaceuticals inc
  • App pharmaceuticals llc
  • Bel mar laboratories inc
  • Bristol myers squibb
  • Organon usa inc
Packagers
  • EMD Canada Inc.
  • Ferring Pharmaceuticals Inc.
  • Merck KGaA
  • Organon Pharmaceuticals
Dosage Forms
FormRouteStrength
Injection, solution250 mcg/500mcL
Injection, solutionSubcutaneous250 ug/0.5mL
SolutionSubcutaneous250 mcg
Solution
Injection, powder, for solutionCutaneous250 MCG
Injection, solutionCutaneous; Parenteral250 MCG/0.5ML
Injection, solutionCutaneous; Parenteral250 MCG
Injection, solutionSubcutaneous250 micrograms/0.5ml
Injection, solutionSubcutaneous250 micrograms
Injection, solutionSubcutaneous250 mcg
KitIntramuscular10000 [USP'U]/10mL
Prices
Unit descriptionCostUnit
Novarel 10000 unit/10ml Solution 1 Vial = 10ml118.55USD vial
Novarel 10000 unit vial113.99USD vial
Ovidrel 250 mcg/0.5ml Injectable 0.5ml Syringe93.22USD syringe
Pregnyl 10000 unit Solution60.7USD vial
Pregnyl 10000 unit vial57.23USD vial
DrugBank does not sell nor buy drugs. Pricing information is supplied for informational purposes only.
Patents
Patent NumberPediatric ExtensionApprovedExpires (estimated)Region
US5767251No1998-06-162015-06-16US flag
US6706681No2004-03-162021-03-16US flag
Additional Data Available
  • Filed On
    Filed On

    The date on which a patent was filed with the relevant government.

    Learn more

Properties

State
Solid
Experimental Properties
PropertyValueSource
melting point (°C)55 °CForastieri, H., Ingham, K.C. J. Biol. Chem. 257:7976-7981 (1982)
hydrophobicity-0.258Not Available
isoelectric point8.61Not Available

Targets

Kind
Protein
Organism
Humans
Pharmacological action
Yes
General Function
Luteinizing hormone receptor activity
Specific Function
Receptor for lutropin-choriogonadotropic hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase.
Gene Name
LHCGR
Uniprot ID
P22888
Uniprot Name
Lutropin-choriogonadotropic hormone receptor
Molecular Weight
78642.01 Da
References
  1. Bodek G, Vierre S, Rivero-Muller A, Huhtaniemi I, Ziecik AJ, Rahman NA: A novel targeted therapy of Leydig and granulosa cell tumors through the luteinizing hormone receptor using a hecate-chorionic gonadotropin beta conjugate in transgenic mice. Neoplasia. 2005 May;7(5):497-508. [PubMed:15967102]
  2. Gromoll J, Wistuba J, Terwort N, Godmann M, Muller T, Simoni M: A new subclass of the luteinizing hormone/chorionic gonadotropin receptor lacking exon 10 messenger RNA in the New World monkey (Platyrrhini) lineage. Biol Reprod. 2003 Jul;69(1):75-80. Epub 2003 Feb 19. [PubMed:12606382]
  3. Lin W, Bernard MP, Cao D, Myers RV, Kerrigan JE, Moyle WR: Follitropin receptors contain cryptic ligand binding sites. Mol Cell Endocrinol. 2007 Jan 2;260-262:83-92. Epub 2006 Oct 23. [PubMed:17059863]
Kind
Protein
Organism
Humans
Pharmacological action
Yes
Actions
Binder
General Function
G-protein coupled peptide receptor activity
Specific Function
Receptor for follicle-stimulating hormone. The activity of this receptor is mediated by G proteins which activate adenylate cyclase. Induces cAMP production through the activation of PI3K-AKT and S...
Gene Name
FSHR
Uniprot ID
P23945
Uniprot Name
Follicle-stimulating hormone receptor
Molecular Weight
78264.07 Da
References
  1. Jameson JL: Inherited disorders of the gonadotropin hormones. Mol Cell Endocrinol. 1996 Dec 20;125(1-2):143-9. [PubMed:9027352]
  2. Lin W, Bernard MP, Cao D, Myers RV, Kerrigan JE, Moyle WR: Follitropin receptors contain cryptic ligand binding sites. Mol Cell Endocrinol. 2007 Jan 2;260-262:83-92. Epub 2006 Oct 23. [PubMed:17059863]
  3. Tao YX, Segaloff DL: Follicle stimulating hormone receptor mutations and reproductive disorders. Prog Mol Biol Transl Sci. 2009;89:115-31. doi: 10.1016/S1877-1173(09)89005-4. Epub 2009 Oct 7. [PubMed:20374735]
  4. Chen X, Ji ZL, Chen YZ: TTD: Therapeutic Target Database. Nucleic Acids Res. 2002 Jan 1;30(1):412-5. [PubMed:11752352]

Drug created on June 13, 2005 07:24 / Updated on October 19, 2020 07:47

Logo pink
Are you a
new drug developer?
Contact us to learn more about our customized products and solutions.
Logo pink
Stay in the know!
As part of our commitment to providing the most up-to-date drug information, we will be releasing #DrugBankUpdates with our newly added curated drug pages.
#DrugBankUpdates