Explore a selection of our essential drug information below, or:
Identification
- Generic Name
- MM-093
- DrugBank Accession Number
- DB05512
- Background
MM-093 is a recombinant version of human alpha-fetoprotein (hAFP), an immunomodulatory serum protein normally produced at very high levels by the fetus and present in low levels in the blood of adults and children. Research on AFP suggests that it may play a role in modulating the immune system of the mother in order to protect the developing fetus during pregnancy. The presence of hAFP in the pregnant mother’s blood has long been associated with remission of many autoimmune diseases, including rheumatoid arthritis, psoriasis and multiple sclerosis, during the third trimester of pregnancy. Current studies are assessing MM-093’s potential to improve the treatment of autoimmune disease.
- Type
- Biotech
- Groups
- Investigational
- Biologic Classification
- Protein Based Therapies
Other protein based therapies - Protein Chemical Formula
- Not Available
- Protein Average Weight
- Not Available
- Sequences
>>Q4QR90|Q4QR90_RAT Alpha-fetoprotein - Rattus norvegicus (Rat). MKQPATMKWSASISFLLLLNFAEPRVLHTNEFGIESTLDSSQCPTEKNMFNVATIVVAQF VQDATKAEVNKMSSDALAAMKENTGDGCLENQLSVFLDEICHETELFNKYGFSGCCNQSG VERHQCLLARKKTAPDSVPPFHFPETAESCPAYEENRAMSINTFIYDVSKRNPFLYAPTI LYLAAQYDKAVPACCKADNMEECFQTKRASMAKELREGSMLNEHVCAVIRKFGSRNLQAV LIIKLSQKFPKANITEIRKLALDVAHIHEQCCHGNAMECLQDGESVMTHICSQQEILSSK TAECCKLPTIELGYCIIHAENGDKPEGLTLNPSEFLGDRNFAQFSSEEKLLFMASFLHEY SRNHPNLPVSVILKTAKSYQEILEKCSQSETPSKCQDNMEEELQKHIQESQALAKQSCDL YQKLGPYYLQNLFLIGYTRKAPQLTSAELIDLTGKMVSIASMCCQLSEEKRSACGEGLAD IYIGHLCLRHEANPVNSGINHCCSSSYSNRRLCITSFLRDETYVPPPFSEDKFIFHKDLC QAQGRALQTMKQELLINLVKQKPEMTEEQHAAVTADFSGLLEKCCKDQDQEACFAKEGPK LISKTREALGV
Download FASTA Format- Synonyms
- Not Available
Pharmacology
- Indication
Investigated for use/treatment in autoimmune diseases, psoriasis and psoriatic disorders, and rheumatoid arthritis.
Reduce drug development failure ratesBuild, train, & validate machine-learning modelswith evidence-based and structured datasets.Build, train, & validate predictive machine-learning models with structured datasets.- Contraindications & Blackbox Warnings
Prevent Adverse Drug Events TodayTap into our Clinical API for life-saving information on contraindications & blackbox warnings, population restrictions, harmful risks, & more.Avoid life-threatening adverse drug events with our Clinical API- Pharmacodynamics
M-093 (Merrimack Pharmaceuticals, Cambridge, Massachusetts, USA) is a non-glycosylated version of human AFP produced by recombinant DNA technology in a transgenic goat expression system.. hAFP is an immunomodulatory serum protein normally produced at very high levels by the fetus and present in low levels in the blood of adults and children. Research on AFP suggests that it may play a role in modulating the immune system of the mother in order to protect the developing fetus during pregnancy. The presence of hAFP in the pregnant mother’s blood has long been associated with remission of many autoimmune diseases, including rheumatoid arthritis, psoriasis and multiple sclerosis, during the third trimester of pregnancy. Current studies are assessing MM-093’s potential to improve the treatment of autoimmune disease.
- Mechanism of action
One study states that AFP suppresses autologous lymphocyte proliferation and that improvements in experimental arthritis and autoimmune thyroiditis were associated with significantly reduced numbers of CD4 and CD8 splenocytes, total thymocytes and CD4 thymocytes. This suggests that AFP modulates T cell development and immune responses.
- Absorption
Not Available
- Volume of distribution
Not Available
- Protein binding
Not Available
- Metabolism
- Not Available
- Route of elimination
Not Available
- Half-life
Not Available
- Clearance
Not Available
- Adverse Effects
Improve decision support & research outcomesWith structured adverse effects data, including: blackbox warnings, adverse reactions, warning & precautions, & incidence rates. View sample adverse effects data in our new Data Library!Improve decision support & research outcomes with our structured adverse effects data.- Toxicity
Not Available
- Pathways
- Not Available
- Pharmacogenomic Effects/ADRs
- Not Available
Interactions
- Drug Interactions
- This information should not be interpreted without the help of a healthcare provider. If you believe you are experiencing an interaction, contact a healthcare provider immediately. The absence of an interaction does not necessarily mean no interactions exist.Not Available
- Food Interactions
- Not Available
Categories
- Drug Categories
- Not Available
- Chemical TaxonomyProvided by Classyfire
- Description
- Not Available
- Kingdom
- Organic Compounds
- Super Class
- Organic Acids
- Class
- Carboxylic Acids and Derivatives
- Sub Class
- Amino Acids, Peptides, and Analogues
- Direct Parent
- Peptides
- Alternative Parents
- Not Available
- Substituents
- Not Available
- Molecular Framework
- Not Available
- External Descriptors
- Not Available
- Affected organisms
- Not Available
Chemical Identifiers
- UNII
- Not Available
- CAS number
- Not Available
References
- General References
- Dudich E: MM-093, a recombinant human alpha-fetoprotein for the potential treatment of rheumatoid arthritis and other autoimmune diseases. Curr Opin Mol Ther. 2007 Dec;9(6):603-10. [Article]
- External Links
- PubChem Substance
- 347910182
Clinical Trials
- Clinical Trials
Clinical Trial & Rare Diseases Add-on Data Package
Explore 4,000+ rare diseases, orphan drugs & condition pairs, clinical trial why stopped data, & more. Preview package Phase Status Purpose Conditions Count Start Date Why Stopped 100+ additional columns Unlock 175K+ rows when you subscribe.View sample data2 Completed Treatment Psoriasis 1 somestatus stop reason just information to hide 2 Completed Treatment Rheumatoid Arthritis 2 somestatus stop reason just information to hide 2 Completed Treatment Uveitis 1 somestatus stop reason just information to hide
Pharmacoeconomics
- Manufacturers
- Not Available
- Packagers
- Not Available
- Dosage Forms
- Not Available
- Prices
- Not Available
- Patents
- Not Available
Properties
- State
- Solid
- Experimental Properties
- Not Available
Drug created at November 18, 2007 18:25 / Updated at June 12, 2020 16:52