Tumor necrosis factor receptor superfamily member 10B

Details

Name
Tumor necrosis factor receptor superfamily member 10B
Synonyms
  • Death receptor 5
  • DR5
  • KILLER
  • TNF-related apoptosis-inducing ligand receptor 2
  • TRAIL receptor 2
  • TRAIL-R2
  • TRAILR2
  • TRICK2
  • ZTNFR9
Gene Name
TNFRSF10B
Organism
Humans
Amino acid sequence
>lcl|BSEQ0037236|Tumor necrosis factor receptor superfamily member 10B
MEQRGQNAPAASGARKRHGPGPREARGARPGPRVPKTLVLVVAAVLLLVSAESALITQQD
LAPQQRAAPQQKRSSPSEGLCPPGHHISEDGRDCISCKYGQDYSTHWNDLLFCLRCTRCD
SGEVELSPCTTTRNTVCQCEEGTFREEDSPEMCRKCRTGCPRGMVKVGDCTPWSDIECVH
KESGTKHSGEVPAVEETVTSSPGTPASPCSLSGIIIGVTVAAVVLIVAVFVCKSLLWKKV
LPYLKGICSGGGGDPERVDRSSQRPGAEDNVLNEIVSILQPTQVPEQEMEVQEPAEPTGV
NMLSPGESEHLLEPAEAERSQRRRLLVPANEGDPTETLRQCFDDFADLVPFDSWEPLMRK
LGLMDNEIKVAKAEAAGHRDTLYTMLIKWVNKTGRDASVHTLLDALETLGERLAKQKIED
HLLSSGKFMYLEGNADSAMS
Number of residues
440
Molecular Weight
47877.885
Theoretical pI
5.25
GO Classification
Functions
receptor activity / TRAIL binding / tumor necrosis factor-activated receptor activity
Processes
activation of cysteine-type endopeptidase activity involved in apoptotic process / activation of cysteine-type endopeptidase activity involved in apoptotic signaling pathway / activation of NF-kappaB-inducing kinase activity / apoptotic process / cell surface receptor signaling pathway / cellular response to mechanical stimulus / extrinsic apoptotic signaling pathway / extrinsic apoptotic signaling pathway via death domain receptors / immune response / inflammatory response / intrinsic apoptotic signaling pathway in response to endoplasmic reticulum stress / multicellular organismal development / necroptotic process / negative regulation of cysteine-type endopeptidase activity involved in apoptotic process / positive regulation of I-kappaB kinase/NF-kappaB signaling / programmed cell death / programmed necrotic cell death / regulation of apoptotic process / regulation of cell proliferation / regulation of extrinsic apoptotic signaling pathway via death domain receptors / regulation of necrotic cell death / response to endoplasmic reticulum stress / response to lipopolysaccharide / tumor necrosis factor-mediated signaling pathway
Components
cell surface / integral component of membrane / integral component of plasma membrane / intracellular / plasma membrane
General Function
Tumor necrosis factor-activated receptor activity
Specific Function
Receptor for the cytotoxic ligand TNFSF10/TRAIL. The adapter molecule FADD recruits caspase-8 to the activated receptor. The resulting death-inducing signaling complex (DISC) performs caspase-8 proteolytic activation which initiates the subsequent cascade of caspases (aspartate-specific cysteine proteases) mediating apoptosis. Promotes the activation of NF-kappa-B. Essential for ER stress-induced apoptosis.
Pfam Domain Function
Transmembrane Regions
211-231
Cellular Location
Membrane
Gene sequence
>lcl|BSEQ0012403|Tumor necrosis factor receptor superfamily member 10B (TNFRSF10B)
ATGGAACAACGGGGACAGAACGCCCCGGCCGCTTCGGGGGCCCGGAAAAGGCACGGCCCA
GGACCCAGGGAGGCGCGGGGAGCCAGGCCTGGGCCCCGGGTCCCCAAGACCCTTGTGCTC
GTTGTCGCCGCGGTCCTGCTGTTGGTCTCAGCTGAGTCTGCTCTGATCACCCAACAAGAC
CTAGCTCCCCAGCAGAGAGCGGCCCCACAACAAAAGAGGTCCAGCCCCTCAGAGGGATTG
TGTCCACCTGGACACCATATCTCAGAAGACGGTAGAGATTGCATCTCCTGCAAATATGGA
CAGGACTATAGCACTCACTGGAATGACCTCCTTTTCTGCTTGCGCTGCACCAGGTGTGAT
TCAGGTGAAGTGGAGCTAAGTCCCTGCACCACGACCAGAAACACAGTGTGTCAGTGCGAA
GAAGGCACCTTCCGGGAAGAAGATTCTCCTGAGATGTGCCGGAAGTGCCGCACAGGGTGT
CCCAGAGGGATGGTCAAGGTCGGTGATTGTACACCCTGGAGTGACATCGAATGTGTCCAC
AAAGAATCAGGTACAAAGCACAGTGGGGAAGTCCCAGCTGTGGAGGAGACGGTGACCTCC
AGCCCAGGGACTCCTGCCTCTCCCTGTTCTCTCTCAGGCATCATCATAGGAGTCACAGTT
GCAGCCGTAGTCTTGATTGTGGCTGTGTTTGTTTGCAAGTCTTTACTGTGGAAGAAAGTC
CTTCCTTACCTGAAAGGCATCTGCTCAGGTGGTGGTGGGGACCCTGAGCGTGTGGACAGA
AGCTCACAACGACCTGGGGCTGAGGACAATGTCCTCAATGAGATCGTGAGTATCTTGCAG
CCCACCCAGGTCCCTGAGCAGGAAATGGAAGTCCAGGAGCCAGCAGAGCCAACAGGTGTC
AACATGTTGTCCCCCGGGGAGTCAGAGCATCTGCTGGAACCGGCAGAAGCTGAAAGGTCT
CAGAGGAGGAGGCTGCTGGTTCCAGCAAATGAAGGTGATCCCACTGAGACTCTGAGACAG
TGCTTCGATGACTTTGCAGACTTGGTGCCCTTTGACTCCTGGGAGCCGCTCATGAGGAAG
TTGGGCCTCATGGACAATGAGATAAAGGTGGCTAAAGCTGAGGCAGCGGGCCACAGGGAC
ACCTTGTACACGATGCTGATAAAGTGGGTCAACAAAACCGGGCGAGATGCCTCTGTCCAC
ACCCTGCTGGATGCCTTGGAGACGCTGGGAGAGAGACTTGCCAAGCAGAAGATTGAGGAC
CACTTGTTGAGCTCTGGAAAGTTCATGTATCTAGAAGGTAATGCAGACTCTGCCATGTCC
TAA
Chromosome Location
8
Locus
Not Available
External Identifiers
ResourceLink
UniProtKB IDO14763
UniProtKB Entry NameTR10B_HUMAN
GenBank Gene IDAF016849
GenAtlas IDTNFRSF10B
HGNC IDHGNC:11905
General References
  1. Screaton GR, Mongkolsapaya J, Xu XN, Cowper AE, McMichael AJ, Bell JI: TRICK2, a new alternatively spliced receptor that transduces the cytotoxic signal from TRAIL. Curr Biol. 1997 Sep 1;7(9):693-6. [Article]
  2. Walczak H, Degli-Esposti MA, Johnson RS, Smolak PJ, Waugh JY, Boiani N, Timour MS, Gerhart MJ, Schooley KA, Smith CA, Goodwin RG, Rauch CT: TRAIL-R2: a novel apoptosis-mediating receptor for TRAIL. EMBO J. 1997 Sep 1;16(17):5386-97. [Article]
  3. Schneider P, Bodmer JL, Thome M, Hofmann K, Holler N, Tschopp J: Characterization of two receptors for TRAIL. FEBS Lett. 1997 Oct 27;416(3):329-34. [Article]
  4. Chaudhary PM, Eby M, Jasmin A, Bookwalter A, Murray J, Hood L: Death receptor 5, a new member of the TNFR family, and DR4 induce FADD-dependent apoptosis and activate the NF-kappaB pathway. Immunity. 1997 Dec;7(6):821-30. [Article]
  5. MacFarlane M, Ahmad M, Srinivasula SM, Fernandes-Alnemri T, Cohen GM, Alnemri ES: Identification and molecular cloning of two novel receptors for the cytotoxic ligand TRAIL. J Biol Chem. 1997 Oct 10;272(41):25417-20. [Article]
  6. Wu GS, Burns TF, McDonald ER 3rd, Jiang W, Meng R, Krantz ID, Kao G, Gan DD, Zhou JY, Muschel R, Hamilton SR, Spinner NB, Markowitz S, Wu G, el-Deiry WS: KILLER/DR5 is a DNA damage-inducible p53-regulated death receptor gene. Nat Genet. 1997 Oct;17(2):141-3. [Article]
  7. Pan G, Ni J, Wei YF, Yu G, Gentz R, Dixit VM: An antagonist decoy receptor and a death domain-containing receptor for TRAIL. Science. 1997 Aug 8;277(5327):815-8. [Article]
  8. Sheridan JP, Marsters SA, Pitti RM, Gurney A, Skubatch M, Baldwin D, Ramakrishnan L, Gray CL, Baker K, Wood WI, Goddard AD, Godowski P, Ashkenazi A: Control of TRAIL-induced apoptosis by a family of signaling and decoy receptors. Science. 1997 Aug 8;277(5327):818-21. [Article]
  9. Arai T, Akiyama Y, Okabe S, Saito K, Iwai T, Yuasa Y: Genomic organization and mutation analyses of the DR5/TRAIL receptor 2 gene in colorectal carcinomas. Cancer Lett. 1998 Nov 27;133(2):197-204. [Article]
  10. Clark HF, Gurney AL, Abaya E, Baker K, Baldwin D, Brush J, Chen J, Chow B, Chui C, Crowley C, Currell B, Deuel B, Dowd P, Eaton D, Foster J, Grimaldi C, Gu Q, Hass PE, Heldens S, Huang A, Kim HS, Klimowski L, Jin Y, Johnson S, Lee J, Lewis L, Liao D, Mark M, Robbie E, Sanchez C, Schoenfeld J, Seshagiri S, Simmons L, Singh J, Smith V, Stinson J, Vagts A, Vandlen R, Watanabe C, Wieand D, Woods K, Xie MH, Yansura D, Yi S, Yu G, Yuan J, Zhang M, Zhang Z, Goddard A, Wood WI, Godowski P, Gray A: The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment. Genome Res. 2003 Oct;13(10):2265-70. Epub 2003 Sep 15. [Article]
  11. Bechtel S, Rosenfelder H, Duda A, Schmidt CP, Ernst U, Wellenreuther R, Mehrle A, Schuster C, Bahr A, Blocker H, Heubner D, Hoerlein A, Michel G, Wedler H, Kohrer K, Ottenwalder B, Poustka A, Wiemann S, Schupp I: The full-ORF clone resource of the German cDNA Consortium. BMC Genomics. 2007 Oct 31;8:399. [Article]
  12. Nusbaum C, Mikkelsen TS, Zody MC, Asakawa S, Taudien S, Garber M, Kodira CD, Schueler MG, Shimizu A, Whittaker CA, Chang JL, Cuomo CA, Dewar K, FitzGerald MG, Yang X, Allen NR, Anderson S, Asakawa T, Blechschmidt K, Bloom T, Borowsky ML, Butler J, Cook A, Corum B, DeArellano K, DeCaprio D, Dooley KT, Dorris L 3rd, Engels R, Glockner G, Hafez N, Hagopian DS, Hall JL, Ishikawa SK, Jaffe DB, Kamat A, Kudoh J, Lehmann R, Lokitsang T, Macdonald P, Major JE, Matthews CD, Mauceli E, Menzel U, Mihalev AH, Minoshima S, Murayama Y, Naylor JW, Nicol R, Nguyen C, O'Leary SB, O'Neill K, Parker SC, Polley A, Raymond CK, Reichwald K, Rodriguez J, Sasaki T, Schilhabel M, Siddiqui R, Smith CL, Sneddon TP, Talamas JA, Tenzin P, Topham K, Venkataraman V, Wen G, Yamazaki S, Young SK, Zeng Q, Zimmer AR, Rosenthal A, Birren BW, Platzer M, Shimizu N, Lander ES: DNA sequence and analysis of human chromosome 8. Nature. 2006 Jan 19;439(7074):331-5. [Article]
  13. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
  14. Hillman RT, Green RE, Brenner SE: An unappreciated role for RNA surveillance. Genome Biol. 2004;5(2):R8. Epub 2004 Feb 2. [Article]
  15. Yamaguchi H, Wang HG: CHOP is involved in endoplasmic reticulum stress-induced apoptosis by enhancing DR5 expression in human carcinoma cells. J Biol Chem. 2004 Oct 29;279(44):45495-502. Epub 2004 Aug 18. [Article]
  16. Smith W, Tomasec P, Aicheler R, Loewendorf A, Nemcovicova I, Wang EC, Stanton RJ, Macauley M, Norris P, Willen L, Ruckova E, Nomoto A, Schneider P, Hahn G, Zajonc DM, Ware CF, Wilkinson GW, Benedict CA: Human cytomegalovirus glycoprotein UL141 targets the TRAIL death receptors to thwart host innate antiviral defenses. Cell Host Microbe. 2013 Mar 13;13(3):324-35. doi: 10.1016/j.chom.2013.02.003. [Article]
  17. Hymowitz SG, Christinger HW, Fuh G, Ultsch M, O'Connell M, Kelley RF, Ashkenazi A, de Vos AM: Triggering cell death: the crystal structure of Apo2L/TRAIL in a complex with death receptor 5. Mol Cell. 1999 Oct;4(4):563-71. [Article]
  18. Mongkolsapaya J, Grimes JM, Chen N, Xu XN, Stuart DI, Jones EY, Screaton GR: Structure of the TRAIL-DR5 complex reveals mechanisms conferring specificity in apoptotic initiation. Nat Struct Biol. 1999 Nov;6(11):1048-53. [Article]
  19. Nemcovicova I, Benedict CA, Zajonc DM: Structure of human cytomegalovirus UL141 binding to TRAIL-R2 reveals novel, non-canonical death receptor interactions. PLoS Pathog. 2013 Mar;9(3):e1003224. doi: 10.1371/journal.ppat.1003224. Epub 2013 Mar 21. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB05895HGS-TR2JinvestigationalunknownDetails
DB06599LexatumumabinvestigationalunknownDetails