Tumor necrosis factor ligand superfamily member 11
Details
- Name
- Tumor necrosis factor ligand superfamily member 11
- Synonyms
- ODF
- OPGL
- Osteoclast differentiation factor
- Osteoprotegerin ligand
- RANKL
- Receptor activator of nuclear factor kappa-B ligand
- TNF-related activation-induced cytokine
- TRANCE
- Gene Name
- TNFSF11
- Organism
- Humans
- Amino acid sequence
>lcl|BSEQ0006789|Tumor necrosis factor ligand superfamily member 11 MRRASRDYTKYLRGSEEMGGGPGAPHEGPLHAPPPPAPHQPPAASRSMFVALLGLGLGQV VCSVALFFYFRAQMDPNRISEDGTHCIYRILRLHENADFQDTTLESQDTKLIPDSCRRIK QAFQGAVQKELQHIVGSQHIRAEKAMVDGSWLDLAKRSKLEAQPFAHLTINATDIPSGSH KVSLSSWYHDRGWAKISNMTFSNGKLIVNQDGFYYLYANICFRHHETSGDLATEYLQLMV YVTKTSIKIPSSHTLMKGGSTKYWSGNSEFHFYSINVGGFFKLRSGEEISIEVSNPSLLD PDQDATYFGAFKVRDID
- Number of residues
- 317
- Molecular Weight
- 35477.81
- Theoretical pI
- 7.74
- GO Classification
- Functionscytokine activity / tumor necrosis factor receptor binding / tumor necrosis factor receptor superfamily bindingProcessesactivation of JUN kinase activity / bone resorption / calcium ion homeostasis / cytokine-mediated signaling pathway / ERK1 and ERK2 cascade / immune response / mammary gland alveolus development / mammary gland epithelial cell proliferation / monocyte chemotaxis / organ morphogenesis / ossification / osteoclast differentiation / osteoclast proliferation / paracrine signaling / positive regulation of bone resorption / positive regulation of corticotropin-releasing hormone secretion / positive regulation of ERK1 and ERK2 cascade via TNFSF11-mediated signaling / positive regulation of fever generation by positive regulation of prostaglandin secretion / positive regulation of homotypic cell-cell adhesion / positive regulation of I-kappaB kinase/NF-kappaB signaling / positive regulation of intracellular signal transduction / positive regulation of MAP kinase activity / positive regulation of NF-kappaB transcription factor activity / positive regulation of osteoclast development / positive regulation of osteoclast differentiation / positive regulation of protein kinase B signaling / positive regulation of sequence-specific DNA binding transcription factor activity / positive regulation of T cell activation / positive regulation of transcription from RNA polymerase II promoter / protein homooligomerization / TNFSF11-mediated signaling pathway / tumor necrosis factor-mediated signaling pathwayComponentscytoplasm / extracellular region / extracellular space / integral component of plasma membrane / plasma membrane
- General Function
- Tumor necrosis factor receptor superfamily binding
- Specific Function
- Cytokine that binds to TNFRSF11B/OPG and to TNFRSF11A/RANK. Osteoclast differentiation and activation factor. Augments the ability of dendritic cells to stimulate naive T-cell proliferation. May be an important regulator of interactions between T-cells and dendritic cells and may play a role in the regulation of the T-cell-dependent immune response. May also play an important role in enhanced bone-resorption in humoral hypercalcemia of malignancy.
- Pfam Domain Function
- TNF (PF00229)
- Transmembrane Regions
- 48-68
- Cellular Location
- Cell membrane
- Gene sequence
>lcl|BSEQ0012451|Tumor necrosis factor ligand superfamily member 11 (TNFSF11) ATGCGCCGCGCCAGCAGAGACTACACCAAGTACCTGCGTGGCTCGGAGGAGATGGGCGGC GGCCCCGGAGCCCCGCACGAGGGCCCCCTGCACGCCCCGCCGCCGCCTGCGCCGCACCAG CCCCCTGCCGCCTCCCGCTCCATGTTCGTGGCCCTCCTGGGGCTGGGGCTGGGCCAGGTT GTCTGCAGCGTCGCCCTGTTCTTCTATTTCAGAGCGCAGATGGATCCTAATAGAATATCA GAAGATGGCACTCACTGCATTTATAGAATTTTGAGACTCCATGAAAATGCAGATTTTCAA GACACAACTCTGGAGAGTCAAGATACAAAATTAATACCTGATTCATGTAGGAGAATTAAA CAGGCCTTTCAAGGAGCTGTGCAAAAGGAATTACAACATATCGTTGGATCACAGCACATC AGAGCAGAGAAAGCGATGGTGGATGGCTCATGGTTAGATCTGGCCAAGAGGAGCAAGCTT GAAGCTCAGCCTTTTGCTCATCTCACTATTAATGCCACCGACATCCCATCTGGTTCCCAT AAAGTGAGTCTGTCCTCTTGGTACCATGATCGGGGTTGGGCCAAGATCTCCAACATGACT TTTAGCAATGGAAAACTAATAGTTAATCAGGATGGCTTTTATTACCTGTATGCCAACATT TGCTTTCGACATCATGAAACTTCAGGAGACCTAGCTACAGAGTATCTTCAACTAATGGTG TACGTCACTAAAACCAGCATCAAAATCCCAAGTTCTCATACCCTGATGAAAGGAGGAAGC ACCAAGTATTGGTCAGGGAATTCTGAATTCCATTTTTATTCCATAAACGTTGGTGGATTT TTTAAGTTACGGTCTGGAGAGGAAATCAGCATCGAGGTCTCCAACCCCTCCTTACTGGAT CCGGATCAGGATGCAACATACTTTGGGGCTTTTAAAGTTCGAGATATAGATTGA
- Chromosome Location
- 13
- Locus
- Not Available
- External Identifiers
Resource Link UniProtKB ID O14788 UniProtKB Entry Name TNF11_HUMAN GenBank Gene ID AF013171 GenAtlas ID TNFSF11 HGNC ID HGNC:11926 - General References
- Anderson DM, Maraskovsky E, Billingsley WL, Dougall WC, Tometsko ME, Roux ER, Teepe MC, DuBose RF, Cosman D, Galibert L: A homologue of the TNF receptor and its ligand enhance T-cell growth and dendritic-cell function. Nature. 1997 Nov 13;390(6656):175-9. [Article]
- Lacey DL, Timms E, Tan HL, Kelley MJ, Dunstan CR, Burgess T, Elliott R, Colombero A, Elliott G, Scully S, Hsu H, Sullivan J, Hawkins N, Davy E, Capparelli C, Eli A, Qian YX, Kaufman S, Sarosi I, Shalhoub V, Senaldi G, Guo J, Delaney J, Boyle WJ: Osteoprotegerin ligand is a cytokine that regulates osteoclast differentiation and activation. Cell. 1998 Apr 17;93(2):165-76. [Article]
- Nagai M, Kyakumoto S, Sato N: Cancer cells responsible for humoral hypercalcemia express mRNA encoding a secreted form of ODF/TRANCE that induces osteoclast formation. Biochem Biophys Res Commun. 2000 Mar 16;269(2):532-6. [Article]
- Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
- Wong BR, Rho J, Arron J, Robinson E, Orlinick J, Chao M, Kalachikov S, Cayani E, Bartlett FS 3rd, Frankel WN, Lee SY, Choi Y: TRANCE is a novel ligand of the tumor necrosis factor receptor family that activates c-Jun N-terminal kinase in T cells. J Biol Chem. 1997 Oct 3;272(40):25190-4. [Article]
- Luan X, Lu Q, Jiang Y, Zhang S, Wang Q, Yuan H, Zhao W, Wang J, Wang X: Crystal structure of human RANKL complexed with its decoy receptor osteoprotegerin. J Immunol. 2012 Jul 1;189(1):245-52. doi: 10.4049/jimmunol.1103387. Epub 2012 Jun 4. [Article]
- Sobacchi C, Frattini A, Guerrini MM, Abinun M, Pangrazio A, Susani L, Bredius R, Mancini G, Cant A, Bishop N, Grabowski P, Del Fattore A, Messina C, Errigo G, Coxon FP, Scott DI, Teti A, Rogers MJ, Vezzoni P, Villa A, Helfrich MH: Osteoclast-poor human osteopetrosis due to mutations in the gene encoding RANKL. Nat Genet. 2007 Aug;39(8):960-2. Epub 2007 Jul 15. [Article]