Neuropilin-2

Details

Name
Neuropilin-2
Synonyms
  • Vascular endothelial cell growth factor 165 receptor 2
  • VEGF165R2
Gene Name
NRP2
Organism
Humans
Amino acid sequence
>lcl|BSEQ0052526|Neuropilin-2
MDMFPLTWVFLALYFSRHQVRGQPDPPCGGRLNSKDAGYITSPGYPQDYPSHQNCEWIVY
APEPNQKIVLNFNPHFEIEKHDCKYDFIEIRDGDSESADLLGKHCGNIAPPTIISSGSML
YIKFTSDYARQGAGFSLRYEIFKTGSEDCSKNFTSPNGTIESPGFPEKYPHNLDCTFTIL
AKPKMEIILQFLIFDLEHDPLQVGEGDCKYDWLDIWDGIPHVGPLIGKYCGTKTPSELRS
STGILSLTFHTDMAVAKDGFSARYYLVHQEPLENFQCNVPLGMESGRIANEQISASSTYS
DGRWTPQQSRLHGDDNGWTPNLDSNKEYLQVDLRFLTMLTAIATQGAISRETQNGYYVKS
YKLEVSTNGEDWMVYRHGKNHKVFQANNDATEVVLNKLHAPLLTRFVRIRPQTWHSGIAL
RLELFGCRVTDAPCSNMLGMLSGLIADSQISASSTQEYLWSPSAARLVSSRSGWFPRIPQ
AQPGEEWLQVDLGTPKTVKGVIIQGARGGDSITAVEARAFVRKFKVSYSLNGKDWEYIQD
PRTQQPKLFEGNMHYDTPDIRRFDPIPAQYVRVYPERWSPAGIGMRLEVLGCDWTDSKPT
VETLGPTVKSEETTTPYPTEEEATECGENCSFEDDKDLQLPSGFNCNFDFLEEPCGWMYD
HAKWLRTTWASSSSPNDRTFPDDRNFLRLQSDSQREGQYARLISPPVHLPRSPVCMEFQY
QATGGRGVALQVVREASQESKLLWVIREDQGGEWKHGRIILPSYDMEYQIVFEGVIGKGR
SGEIAIDDIRISTDVPLENCMEPISAFAGENFKVDIPEIHEREGYEDEIDDEYEVDWSNS
SSATSGSGAPSTDKEKSWLYTLDPILITIIAMSSLGVLLGATCAGLLLYCTCSYSGLSSR
SCTTLENYNFELYDGLKHKVKMNHQKCCSEA
Number of residues
931
Molecular Weight
104829.73
Theoretical pI
Not Available
GO Classification
Functions
cytokine binding / growth factor binding / heparin binding / identical protein binding / metal ion binding / semaphorin receptor activity / signaling receptor activity / vascular endothelial growth factor-activated receptor activity
Processes
angiogenesis / axon extension involved in axon guidance / axon guidance / cell adhesion / cellular response to leukemia inhibitory factor / dorsal root ganglion morphogenesis / facial nerve structural organization / facioacoustic ganglion development / gonadotrophin-releasing hormone neuronal migration to the hypothalamus / negative chemotaxis / nerve development / neural crest cell migration involved in autonomic nervous system development / outflow tract septum morphogenesis / positive regulation of endothelial cell migration / positive regulation of endothelial cell proliferation / regulation of postsynapse organization / semaphorin-plexin signaling pathway involved in neuron projection guidance / sensory neuron axon guidance / sympathetic ganglion development / sympathetic neuron projection extension / sympathetic neuron projection guidance / trigeminal ganglion development / vascular endothelial growth factor receptor signaling pathway / ventral trunk neural crest cell migration / vestibulocochlear nerve structural organization / viral process
Components
axon / extracellular region / glutamatergic synapse / integral component of membrane / membrane / plasma membrane / semaphorin receptor complex
General Function
High affinity receptor for semaphorins 3C, 3F, VEGF-165 and VEGF-145 isoforms of VEGF, and the PLGF-2 isoform of PGF.
Specific Function
Cytokine binding
Pfam Domain Function
Transmembrane Regions
865-889
Cellular Location
Membrane
Gene sequence
>lcl|BSEQ0052527|Neuropilin-2 (NRP2)
ATGGATATGTTTCCTCTCACCTGGGTTTTCTTAGCCCTCTACTTTTCAAGACACCAAGTG
AGAGGCCAACCAGACCCACCGTGCGGAGGTCGTTTGAATTCCAAAGATGCTGGCTATATC
ACCTCTCCCGGTTACCCCCAGGACTACCCCTCCCACCAGAACTGCGAGTGGATTGTTTAC
GCCCCCGAACCCAACCAGAAGATTGTCCTCAACTTCAACCCTCACTTTGAAATCGAGAAG
CACGACTGCAAGTATGACTTTATCGAGATTCGGGATGGGGACAGTGAATCCGCAGACCTC
CTGGGCAAACACTGTGGGAACATCGCCCCGCCCACCATCATCTCCTCGGGCTCCATGCTC
TACATCAAGTTCACCTCCGACTACGCCCGGCAGGGGGCAGGCTTCTCTCTGCGCTACGAG
ATCTTCAAGACAGGCTCTGAAGATTGCTCAAAAAACTTCACAAGCCCCAACGGGACCATC
GAATCTCCTGGGTTTCCTGAGAAGTATCCACACAACTTGGACTGCACCTTTACCATCCTG
GCCAAACCCAAGATGGAGATCATCCTGCAGTTCCTGATCTTTGACCTGGAGCATGACCCT
TTGCAGGTGGGAGAGGGGGACTGCAAGTACGATTGGCTGGACATCTGGGATGGCATTCCA
CATGTTGGCCCCCTGATTGGCAAGTACTGTGGGACCAAAACACCCTCTGAACTTCGTTCA
TCGACGGGGATCCTCTCCCTGACCTTTCACACGGACATGGCGGTGGCCAAGGATGGCTTC
TCTGCGCGTTACTACCTGGTCCACCAAGAGCCACTAGAGAACTTTCAGTGCAATGTTCCT
CTGGGCATGGAGTCTGGCCGGATTGCTAATGAACAGATCAGTGCCTCATCTACCTACTCT
GATGGGAGGTGGACCCCTCAACAAAGCCGGCTCCATGGTGATGACAATGGCTGGACCCCC
AACTTGGATTCCAACAAGGAGTATCTCCAGGTGGACCTGCGCTTTTTAACCATGCTCACG
GCCATCGCAACACAGGGAGCGATTTCCAGGGAAACACAGAATGGCTACTATGTCAAATCC
TACAAGCTGGAAGTCAGCACTAATGGAGAGGACTGGATGGTGTACCGGCATGGCAAAAAC
CACAAGGTATTTCAAGCCAACAACGATGCAACTGAGGTGGTTCTGAACAAGCTCCACGCT
CCACTGCTGACAAGGTTTGTTAGAATCCGCCCTCAGACCTGGCACTCAGGTATCGCCCTC
CGGCTGGAGCTCTTCGGCTGCCGGGTCACAGATGCTCCCTGCTCCAACATGCTGGGGATG
CTCTCAGGCCTCATTGCAGACTCCCAGATCTCCGCCTCTTCCACCCAGGAATACCTCTGG
AGCCCCAGTGCAGCCCGCCTGGTTAGCAGCCGCTCGGGCTGGTTCCCTCGAATCCCTCAG
GCCCAGCCCGGTGAGGAGTGGCTTCAGGTAGATCTGGGAACACCCAAGACAGTGAAAGGT
GTCATCATCCAGGGAGCCCGCGGAGGAGACAGTATCACTGCTGTGGAAGCCAGAGCATTT
GTGCGCAAGTTCAAAGTCTCCTACAGCCTAAACGGCAAGGACTGGGAATACATTCAGGAC
CCCAGGACCCAGCAGCCAAAGCTGTTCGAAGGGAACATGCACTATGACACCCCTGACATC
CGAAGGTTTGACCCCATTCCGGCACAGTATGTGCGGGTATACCCGGAGAGGTGGTCGCCG
GCGGGGATTGGGATGCGGCTGGAGGTGCTGGGCTGTGACTGGACAGACTCCAAGCCCACG
GTAGAGACGCTGGGACCCACTGTGAAGAGCGAAGAGACAACCACCCCCTACCCCACCGAA
GAGGAGGCCACAGAGTGTGGGGAGAACTGCAGCTTTGAGGATGACAAAGATTTGCAGCTC
CCTTCGGGATTCAATTGCAACTTCGATTTCCTCGAGGAGCCCTGTGGTTGGATGTATGAC
CATGCCAAGTGGCTCCGGACCACCTGGGCCAGCAGCTCCAGCCCAAACGACCGGACGTTT
CCAGATGACAGGAATTTCTTGCGGCTGCAGAGTGACAGCCAGAGAGAGGGCCAGTATGCC
CGGCTCATCAGCCCCCCTGTCCACCTGCCCCGAAGCCCGGTGTGCATGGAGTTCCAGTAC
CAGGCCACGGGCGGCCGCGGGGTGGCGCTGCAGGTGGTGCGGGAAGCCAGCCAGGAGAGC
AAGTTGCTGTGGGTCATCCGTGAGGACCAGGGCGGCGAGTGGAAGCACGGGCGGATCATC
CTGCCCAGCTACGACATGGAGTACCAGATTGTGTTCGAGGGAGTGATAGGGAAAGGACGT
TCCGGAGAGATTGCCATTGATGACATTCGGATAAGCACTGATGTCCCACTGGAGAACTGC
ATGGAACCCATCTCGGCTTTTGCAGGTGAGAATTTTAAAGTGGACATCCCAGAAATACAT
GAGAGAGAAGGATATGAAGATGAAATTGATGATGAATACGAGGTGGACTGGAGCAATTCT
TCTTCTGCAACCTCAGGGTCTGGCGCCCCCTCGACCGACAAAGAAAAGAGCTGGCTGTAC
ACCCTGGATCCCATCCTCATCACCATCATCGCCATGAGCTCACTGGGCGTCCTCCTGGGG
GCCACCTGTGCAGGCCTCCTGCTCTACTGCACCTGTTCCTACTCGGGCCTGAGCTCCCGA
AGCTGCACCACACTGGAGAACTACAACTTCGAGCTCTACGATGGCCTTAAGCACAAGGTC
AAGATGAACCACCAAAAGTGCTGCTCCGAGGCATGA
Chromosome Location
2
Locus
2q33.3
External Identifiers
ResourceLink
UniProtKB IDO60462
UniProtKB Entry NameNRP2_HUMAN
HGNC IDHGNC:8005
General References
  1. Chen H, Chedotal A, He Z, Goodman CS, Tessier-Lavigne M: Neuropilin-2, a novel member of the neuropilin family, is a high affinity receptor for the semaphorins Sema E and Sema IV but not Sema III. Neuron. 1997 Sep;19(3):547-59. doi: 10.1016/s0896-6273(00)80371-2. [Article]
  2. Soker S, Takashima S, Miao HQ, Neufeld G, Klagsbrun M: Neuropilin-1 is expressed by endothelial and tumor cells as an isoform-specific receptor for vascular endothelial growth factor. Cell. 1998 Mar 20;92(6):735-45. [Article]
  3. Rossignol M, Gagnon ML, Klagsbrun M: Genomic organization of human neuropilin-1 and neuropilin-2 genes: identification and distribution of splice variants and soluble isoforms. Genomics. 2000 Dec 1;70(2):211-22. doi: 10.1006/geno.2000.6381. [Article]
  4. Hillier LW, Graves TA, Fulton RS, Fulton LA, Pepin KH, Minx P, Wagner-McPherson C, Layman D, Wylie K, Sekhon M, Becker MC, Fewell GA, Delehaunty KD, Miner TL, Nash WE, Kremitzki C, Oddy L, Du H, Sun H, Bradshaw-Cordum H, Ali J, Carter J, Cordes M, Harris A, Isak A, van Brunt A, Nguyen C, Du F, Courtney L, Kalicki J, Ozersky P, Abbott S, Armstrong J, Belter EA, Caruso L, Cedroni M, Cotton M, Davidson T, Desai A, Elliott G, Erb T, Fronick C, Gaige T, Haakenson W, Haglund K, Holmes A, Harkins R, Kim K, Kruchowski SS, Strong CM, Grewal N, Goyea E, Hou S, Levy A, Martinka S, Mead K, McLellan MD, Meyer R, Randall-Maher J, Tomlinson C, Dauphin-Kohlberg S, Kozlowicz-Reilly A, Shah N, Swearengen-Shahid S, Snider J, Strong JT, Thompson J, Yoakum M, Leonard S, Pearman C, Trani L, Radionenko M, Waligorski JE, Wang C, Rock SM, Tin-Wollam AM, Maupin R, Latreille P, Wendl MC, Yang SP, Pohl C, Wallis JW, Spieth J, Bieri TA, Berkowicz N, Nelson JO, Osborne J, Ding L, Meyer R, Sabo A, Shotland Y, Sinha P, Wohldmann PE, Cook LL, Hickenbotham MT, Eldred J, Williams D, Jones TA, She X, Ciccarelli FD, Izaurralde E, Taylor J, Schmutz J, Myers RM, Cox DR, Huang X, McPherson JD, Mardis ER, Clifton SW, Warren WC, Chinwalla AT, Eddy SR, Marra MA, Ovcharenko I, Furey TS, Miller W, Eichler EE, Bork P, Suyama M, Torrents D, Waterston RH, Wilson RK: Generation and annotation of the DNA sequences of human chromosomes 2 and 4. Nature. 2005 Apr 7;434(7034):724-31. [Article]
  5. Gerhard DS, Wagner L, Feingold EA, Shenmen CM, Grouse LH, Schuler G, Klein SL, Old S, Rasooly R, Good P, Guyer M, Peck AM, Derge JG, Lipman D, Collins FS, Jang W, Sherry S, Feolo M, Misquitta L, Lee E, Rotmistrovsky K, Greenhut SF, Schaefer CF, Buetow K, Bonner TI, Haussler D, Kent J, Kiekhaus M, Furey T, Brent M, Prange C, Schreiber K, Shapiro N, Bhat NK, Hopkins RF, Hsie F, Driscoll T, Soares MB, Casavant TL, Scheetz TE, Brown-stein MJ, Usdin TB, Toshiyuki S, Carninci P, Piao Y, Dudekula DB, Ko MS, Kawakami K, Suzuki Y, Sugano S, Gruber CE, Smith MR, Simmons B, Moore T, Waterman R, Johnson SL, Ruan Y, Wei CL, Mathavan S, Gunaratne PH, Wu J, Garcia AM, Hulyk SW, Fuh E, Yuan Y, Sneed A, Kowis C, Hodgson A, Muzny DM, McPherson J, Gibbs RA, Fahey J, Helton E, Ketteman M, Madan A, Rodrigues S, Sanchez A, Whiting M, Madari A, Young AC, Wetherby KD, Granite SJ, Kwong PN, Brinkley CP, Pearson RL, Bouffard GG, Blakesly RW, Green ED, Dickson MC, Rodriguez AC, Grimwood J, Schmutz J, Myers RM, Butterfield YS, Griffith M, Griffith OL, Krzywinski MI, Liao N, Morin R, Palmquist D, Petrescu AS, Skalska U, Smailus DE, Stott JM, Schnerch A, Schein JE, Jones SJ, Holt RA, Baross A, Marra MA, Clifton S, Makowski KA, Bosak S, Malek J: The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 2004 Oct;14(10B):2121-7. [Article]
  6. Gluzman-Poltorak Z, Cohen T, Herzog Y, Neufeld G: Neuropilin-2 is a receptor for the vascular endothelial growth factor (VEGF) forms VEGF-145 and VEGF-165 [corrected]. J Biol Chem. 2000 Jun 16;275(24):18040-5. [Article]
  7. Tamagnone L, Artigiani S, Chen H, He Z, Ming GI, Song H, Chedotal A, Winberg ML, Goodman CS, Poo M, Tessier-Lavigne M, Comoglio PM: Plexins are a large family of receptors for transmembrane, secreted, and GPI-anchored semaphorins in vertebrates. Cell. 1999 Oct 1;99(1):71-80. [Article]
  8. Martinez-Martin N, Marcandalli J, Huang CS, Arthur CP, Perotti M, Foglierini M, Ho H, Dosey AM, Shriver S, Payandeh J, Leitner A, Lanzavecchia A, Perez L, Ciferri C: An Unbiased Screen for Human Cytomegalovirus Identifies Neuropilin-2 as a Central Viral Receptor. Cell. 2018 Aug 23;174(5):1158-1171.e19. doi: 10.1016/j.cell.2018.06.028. Epub 2018 Jul 26. [Article]
  9. Appleton BA, Wu P, Maloney J, Yin J, Liang WC, Stawicki S, Mortara K, Bowman KK, Elliott JM, Desmarais W, Bazan JF, Bagri A, Tessier-Lavigne M, Koch AW, Wu Y, Watts RJ, Wiesmann C: Structural studies of neuropilin/antibody complexes provide insights into semaphorin and VEGF binding. EMBO J. 2007 Nov 28;26(23):4902-12. Epub 2007 Nov 8. [Article]
  10. Veeramah KR, O'Brien JE, Meisler MH, Cheng X, Dib-Hajj SD, Waxman SG, Talwar D, Girirajan S, Eichler EE, Restifo LL, Erickson RP, Hammer MF: De novo pathogenic SCN8A mutation identified by whole-genome sequencing of a family quartet affected by infantile epileptic encephalopathy and SUDEP. Am J Hum Genet. 2012 Mar 9;90(3):502-10. doi: 10.1016/j.ajhg.2012.01.006. Epub 2012 Feb 23. [Article]

Drug Relations

Drug Relations
DrugBank IDNameDrug groupPharmacological action?ActionsDetails
DB16453ATYR1923investigationalyesmodulatorDetails